KEGG   Shewanella sp. MR-7: Shewmr7_3120Help
Entry
Shewmr7_3120      CDS       T00389                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00670  One carbon pool by folate
shm00790  Folate biosynthesis
shm01100  Metabolic pathways
Module
shm_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Shewmr7_3120
   00670 One carbon pool by folate
    Shewmr7_3120
Enzymes [BR:shm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Shewmr7_3120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1 CreA
Motif
Other DBs
NCBI-ProteinID: ABI44104
JGI: Shewmr73120
UniProt: Q0HS01
Position
complement(3701154..3701636)
Genome map
AA seq 160 aa AA seqDB search
MRIAMIAAMANNRVIGKDNKMPWHLPEDLRHFKAMTLGKPVVMGRKTFESIGRPLPGRHN
IVISRQADLQIEGVTCVTSFEDAKLAAGDCEELVVIGGGQLYQQLLPQADTLYLTQINLE
VEGDTFFPAWDSDKWQETESVTSINADGLEYRFINLTKKC
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattgctatgatagccgcgatggcaaacaatcgagtcatcggaaaagacaataaa
atgccatggcatctgccagaagatttacgccactttaaagccatgaccttaggtaaaccc
gtagtgatggggcgtaaaaccttcgagtctattggtagacctctgccagggcgccacaat
attgtgatttcccgccaagcggatttacagattgaaggcgtgacctgcgtgacctcattt
gaagatgccaaattggcggccggcgattgcgaagaattggtcgttatcggtggcgggcaa
ttgtatcaacaattattacctcaagccgacacactctatctgactcagattaacttagag
gttgaaggcgataccttcttccctgcatgggatagcgataaatggcaagaaaccgaatcg
gtaaccagtataaatgccgatgggctggaatatcgctttatcaatttgacaaaaaaatgt
taa

DBGET integrated database retrieval system