KEGG   Shewanella sp. MR-7: Shewmr7_3184Help
Entry
Shewmr7_3184      CDS       T00389                                 

Gene name
metH
Definition
B12-dependent methionine synthase (EC:2.1.1.13)
Orthology
K00548  
5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
shm  Shewanella sp. MR-7
Pathway
Cysteine and methionine metabolism
Selenocompound metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Shewmr7_3184 (metH)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Shewmr7_3184 (metH)
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    Shewmr7_3184 (metH)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Shewmr7_3184 (metH)
Enzymes [BR:shm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     Shewmr7_3184 (metH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3759469..3763203
Genome map
AA seq 1244 aa AA seqDB search
MAISLHRASQTLADIRNQLSKRILILDGAMGTMIQGYKLEEADYRGERFKDWHTDVKGNN
DLLVLTQPHIIKQIHTDYLLAGADIIETNTFNATTIAMADYDMQSLSAEINREGARLARE
ACDEIEKATGKPRYVAGVLGPTNRTCSISPDVNDPGYRNIHFDELVTAYCESTRALIEGG
ADIIMVETIFDTLNAKAALFAIETVFDELFGANSPARLPVMISGTITDASGRTLTGQTTE
AFYNSLRHIKPLSIGLNCALGPKELRPYVEELSRIAECYVSAHPNAGLPNEFGGYDETPE
DMASVIQEWASEGMLNIIGGCCGSTPEHIKVIREAVEPFAPRVLPEIPVACRLSGLEPLT
IDAQTLFVNVGERTNVTGSAKFLKLIKEGKFEQALDVAREQVESGAQIIDINMDEGMLDG
VEVMHKFLNLIASEPDISRVPIMIDSSKWEVIEAGLKCIQGKGIVNSISLKEGEEKFIEQ
ATLVKRYGAAAIIMAFDEQGQADTKARKVEICTRAYRVLVDKVGFPPEDIIFDPNIFAIA
TGIDEHDNYAVDFIEAIKEIKATLPHAMISGGVSNVSFSFRGNNPVREAIHAVFLYHAIK
VGMDMGIVNAGQLAIYDDIDPELKDKVENVVLNLPCPVEGSNNTEQLLEIAEKFRGDGSS
AAKKEDLEWRSWPVNQRLAHALVKGITEFIDEDTEAARQLASRPLDVIEGPLMDGMNIVG
DLFGSGKMFLPQVVKSARVMKKAVAYLNPFIEQEKVEGQSNGRILMVTVKGDVHDIGKNI
VGVVLACNGFEVFDLGVMVSVERILEAVKEHNIDIIGMSGLITPSLDEMVHNVKTFHREG
LTIPAIIGGATCSKIHTAVKIAPHYPHGAIYIADASRAVPMVSKLVSNETRQATIDETYA
EYEEMRVKRLSQTKRKEIVSLEAARENRCQHDWANYTPFKPNVLGRQVFEDYPLTDLVDR
IDWTPFFRAWELHGHYPEILTDKVVGVEAQKLFADGQAMLKKIIDEKWLTAKGVIGLFPA
NTVGFDDIELYTDETRTEVEMTTHHLRMQLERVGNDNFCLADFVAPKDSGVADYMGGFAV
TAGHGIDEHIARFEANHDDYNAIMLKCLADRLAEAFAERMHERVRKEFWGYAADEQLDNE
ALIREKYKGIRPAPGYPACPDHTEKGLLWELLKPNETIDLNITESYAMFPTAAVSGWYFA
HPKSRYFGVTNIGRDQVEDYAKRKGMTVAETEKWLAPVLDYDPE
NT seq 3735 nt NT seq  +upstreamnt  +downstreamnt
atggcgatatctctccatcgagccagccaaacactggcagacattcgcaaccagttgtca
aagcgcattctgattttagacggcgccatgggcactatgatccaaggctacaagctggaa
gaagccgattaccgtggcgagcgtttcaaggattggcataccgacgttaagggcaataac
gatcttttagtgctcacgcagccgcacatcatcaaacaaattcacaccgactacctatta
gccggtgccgatattattgaaaccaacaccttcaacgccaccactatcgccatggccgac
tacgacatgcagtcgctgtccgccgaaattaaccgtgaaggcgcgcgcctcgcccgtgag
gcctgtgacgaaatcgaaaaagccacggggaaaccccgttatgttgccggtgtgttaggg
cccactaaccgcacttgttctatcagccccgatgttaacgatcccggatatcgcaatatc
cacttcgatgagttagtgaccgcttactgcgaatcgacccgcgccttaattgaaggcggc
gccgatatcattatggtcgagaccatcttcgataccttaaacgctaaggccgccttattt
gccatcgaaaccgtgttcgatgaactctttggggcaaattcaccagcacgtttgcccgtg
atgatctcaggcaccattaccgatgcctcgggccgaaccctgaccggacaaaccaccgaa
gctttttataactcccttcgccatatcaagcccttgtccatcggccttaactgcgccctc
ggccctaaggagctgcgcccctacgtcgaagaactgtcgcgcatcgccgaatgttatgtc
tcggcgcaccctaacgcgggtctaccaaacgagtttggcggttacgatgaaaccccagaa
gatatggcgagcgttatccaagaatgggccagtgaaggcatgctcaacattatcggcggc
tgctgtggtagcacgcccgagcatattaaggtcattcgcgaagccgttgagccgtttgcg
ccacgggtactacccgagatccccgtcgcctgccgtttatcgggtttggaaccgctcact
atcgacgcccaaaccctgtttgtgaacgtgggtgaacgtaccaacgttactggctcggcc
aagttcttaaagctgatcaaagaaggtaaattcgagcaggcgctcgatgtcgcccgtgaa
caggtagaaagcggcgcgcagatcatcgacatcaacatggatgaaggcatgctcgatggt
gtggaggtgatgcataagtttttaaatcttatcgcctctgagccggatatcagccgtgta
ccgattatgatcgactcctctaagtgggaggtgattgaagcgggcctcaaatgtattcaa
ggcaagggaatcgtcaactctatctccttgaaggaaggcgaggagaagtttatcgagcag
gcaaccctagttaaacgctacggcgcagcggccattattatggcgttcgacgagcaaggt
caggccgacactaaggcgcgtaaagtcgagatctgtacccgcgcctaccgcgtactggtc
gataaggtcggctttccgcccgaagacattatcttcgacccgaatatcttcgccatcgcc
acgggtatcgatgagcacgataactatgccgtcgattttattgaagccattaaagagatt
aaggccaccctgccccacgcgatgatttccggcggggtgtcgaacgtgtcgttctccttc
cgcggtaacaaccctgtgcgtgaggccattcacgcggtgttcctgtaccacgcgattaaa
gtcggcatggacatgggtatcgtcaacgcgggccaattagcgatttacgatgatatcgac
cccgaacttaaggataaggtcgagaacgtcgtgctcaacctgccttgtcctgttgaaggc
tcaaacaataccgagcaattgcttgagattgctgaaaaattccgtggcgatggctcaagt
gccgccaagaaagaagacttagaatggcgctcatggccagttaatcaacgtctcgcccat
gcgctggtcaaaggcatcaccgaatttatcgacgaagatactgaagcggctcgtcagctc
gcctcccgtccgctggatgtgattgaaggcccgttgatggacggtatgaatatcgtcggc
gacctgtttggctcgggcaaaatgttcctgccacaggtggtgaagtcggcgcgggtgatg
aaaaaggccgtagcctacctcaacccctttatcgagcaagagaaggtcgaaggccaatct
aacggcagaattttgatggtgacggttaagggcgatgtgcacgatatcggcaagaatatt
gtcggcgtggtgctcgcctgtaacggctttgaggtattcgatttaggcgtgatggtgtcg
gtggagcgcattctcgaagcagtgaaagagcacaatatcgacattatcggcatgtctggg
cttatcaccccaagcctcgatgagatggtgcacaatgtgaaaaccttccaccgtgaaggc
ctcaccattccggcgattatcggcggcgcgacctgctcgaaaatccataccgcggtgaag
attgcgccccattatccccatggcgcgatttacattgccgacgcctcgcgcgccgtgcct
atggtcagcaagctggtgagcaatgaaactcgccaagccactatcgatgagacctacgcc
gaatacgaagagatgcgcgttaagcgtttatcgcaaaccaagcgtaaggaaattgtctcg
ctggaagccgcccgcgaaaaccgctgccagcacgactgggcaaactacaccccgttcaag
cccaatgtgctgggtcgccaagtatttgaagactatccattaaccgacttagtcgaccgt
atcgactggacgccgttcttccgcgcttgggagctacacggccattaccctgagatctta
accgacaaggtagtgggggttgaggcgcagaaactgttcgccgatggtcaggccatgctt
aagaaaatcatcgatgaaaaatggcttaccgccaagggcgtgattgggctattccccgcc
aatactgtcggcttcgatgatattgagctctataccgacgagactcgcaccgaagtcgaa
atgactacccatcacctgcggatgcagcttgagcgtgtgggtaacgataacttctgtctg
gccgactttgtggcgccaaaggacagcggcgttgccgactatatgggcggttttgccgtg
accgcaggccatggtatcgatgagcatatcgcccgctttgaggccaaccacgatgactac
aacgccattatgctcaagtgcttagccgaccgtttagccgaagcctttgccgagcggatg
cacgagcgcgtgcgtaaggaattctggggttatgccgccgatgagcagctcgataacgaa
gccttaattcgtgagaaatacaaagggatccgccccgcaccgggttaccccgcctgcccg
gatcacaccgaaaaaggcctgctgtgggaactgttaaagccgaatgaaaccatcgactta
aacattaccgaaagctacgccatgttccccaccgcagcggtatcgggctggtactttgcc
cacccgaaatcccgctactttggcgtgaccaatattggtcgcgatcaggtagaggattac
gctaagcgtaaggggatgactgttgcagagacggagaagtggctagcgccagtacttgac
tatgatcccgagtga

DBGET integrated database retrieval system