KEGG   Shewanella sp. MR-7: Shewmr7_3227Help
Entry
Shewmr7_3227      CDS       T00389                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
shm  Shewanella sp. MR-7
Brite
Enzymes [BR:shm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Shewmr7_3227
Secretion system [BR:shm02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Shewmr7_3227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3820829..3821554)
Genome map
AA seq 241 aa AA seqDB search
MKLTRALSLVFALVVAPLASAATATTPDTAAIKQKLSEMLDVEVISMQDSPIEGLYQAMT
NRGVLYISRDGSKLFHGNLYDIDKGMKNLTEAALAGPRLAMMKPLEDHMLVYKAKDEKHV
VTVFTDVSCGYCRKLHSQMADYNKLGITVRYLAFPRAGVPSANADEMQAIWCAKDPLKAM
TEAKAGKKVSAATCDAKIAEQYELGTSFGVNGTPAIVLEDGNMIPGYQPPADLLRTLEAR
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgacccgagcattatctttagttttcgcgcttgttgttgcgcctctggccagc
gccgctacggcgaccactcccgacacagctgcgattaagcaaaaactcagcgagatgtta
gacgttgaagtgatttcaatgcaggattcaccgatcgaaggtttatatcaagccatgacc
aaccgtggcgtgctttatatcagccgcgatggctcaaaactgttccacggtaatttatac
gatattgataagggcatgaaaaacctgacggaagcggcgcttgcaggccctcgtctggcg
atgatgaagccgcttgaagatcatatgttggtatataaagccaaggatgaaaaacacgtt
gtgactgtgtttaccgatgtgagctgtggttactgccgtaagttacatagccaaatggca
gactacaacaagctgggcattaccgtgcgttacttagccttcccacgtgctggtgtacca
tctgccaatgccgatgagatgcaggctatttggtgtgctaaggatccattaaaggccatg
acagaagctaaggctggcaaaaaagtatccgccgcgacctgtgatgccaagattgccgag
caatatgagctaggtaccagctttggcgttaacggcacgcctgcaatcgtattggaagac
ggtaatatgatcccaggatatcaaccacctgccgatctactgcgtactttagaagctcgc
aaataa

DBGET integrated database retrieval system