KEGG   Shewanella sp. MR-7: Shewmr7_3295Help
Entry
Shewmr7_3295      CDS       T00389                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
shm  Shewanella sp. MR-7
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:shm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3899382..3899870
Genome map
AA seq 162 aa AA seqDB search
MTQVFVALGANLEDPKAQLDNAVAALSALAENKSLKVSPYYGSAPMGDVVQPDYINAVAS
FETTLAPIALLDALQEIENTQGRVRKERWGPRTLDLDLLLYGDEIIDKPRLKVPHYGMKE
RSFVLVPLAAIAPDLVLPCKTPLRSLISEKFLAELQLLGNDH
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagtttttgtcgccctcggggcaaatcttgaagatcccaaagctcaattggac
aatgccgttgcggccttgtccgccttggctgaaaataaaagcctcaaggtatcgccctat
tacggctcagctcccatgggagacgtagtgcaacccgactatatcaatgccgttgccagc
tttgagacaacactggcacccatcgctctgttggatgcactgcaagagattgaaaatact
cagggccgcgtccgtaaagagcgttggggccccagaaccttagatctcgacttactctta
tatggcgacgaaatcatcgataaacccagactcaaagtgccgcactatggcatgaaggag
cgtagttttgtgctagtgcccttggcagccattgcacccgatttagtgttgccctgtaaa
acgccgctacgcagccttatcagtgaaaaattcttggccgagttacaactactgggcaat
gatcattga

DBGET integrated database retrieval system