KEGG   Shewanella sp. MR-7: Shewmr7_3334Help
Entry
Shewmr7_3334      CDS       T00389                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
shm  Shewanella sp. MR-7
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Shewmr7_3334
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Shewmr7_3334
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Shewmr7_3334
Enzymes [BR:shm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Shewmr7_3334
Exosome [BR:shm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Shewmr7_3334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3949533..3950927
Genome map
AA seq 464 aa AA seqDB search
MSFTKAPLLLLGMSLWLSTSALAVEAGANETGPVKAPSRPKNIVIMIGDGMGPSYTSAYR
YYKDNPDTEEVEQTVFDRLLVGMASTYPASVSGYVTDSAAAATALATGVKSYNGAISVDT
QKQPLPTIFEKAKTLGLSTGVAVTSQINHATPAAFLSHNESRKNYDALALSYLETNADVF
LGGGQKYFPPELLAQFTAKGYQHITRFDDLASITQPKVLGLFAEVQLPWAIDEKDAKKLS
TLTQKALSLLSQNEQGFVLLVEGSLIDWAGHNNDIAAAMGEMDEFANAIEVVEQFVRQNP
DTLMVITADHNTGGLSIGADGNYNWNPEILRNISASSDTLAQAALGGDTWQADLSRGLGF
ELTEEEVTKLNVARMQGLETMAVAIRHVIDKRTDTGWTTGGHTGTDVQVFAAGPASELFN
GHQDNTDIANKIFSLLPKPKKPKATAQVSTPAPAPELAPVQSQG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcaccaaagcgccactgttattgcttggtatgagtttatggctctccacctcc
gcactggcagtcgaagcaggagcgaatgagactggcccagtaaaagccccctcacgcccg
aaaaatattgtgatcatgattggcgacggcatggggccttcctataccagtgcctatcgt
tattacaaggacaatccagataccgaagaagtcgaacaaaccgttttcgaccgtttattg
gttggcatggcgagcacttatcccgccagcgtcagtggttatgtgaccgactcagccgcc
gccgcgactgccctcgcgacaggagtcaaatcctataacggcgccatttcggtcgatacc
caaaaacaaccactgcctaccatttttgaaaaggccaaaaccttaggcttgagcacgggt
gtggcggtcacgtcgcaaatcaaccatgccacgccagcggcctttttatcccataacgag
agccgtaaaaactacgacgcactggcattaagttatcttgaaaccaacgccgatgtgttt
ttaggtggcgggcaaaagtactttcctccagagctgttagcccagttcaccgccaagggt
tatcaacacattacccgctttgacgatctggccagcattacccagcctaaggtcttgggt
ctgtttgccgaggtgcaactgccttgggcgattgatgaaaaagatgctaaaaaactcagc
accttgactcaaaaagccctcagtttactgtcgcaaaatgagcaaggctttgtgctgctg
gtcgaaggtagccttatcgactgggcgggacacaacaatgatatcgccgccgccatgggc
gaaatggatgaatttgccaatgcgattgaagtcgtcgaacaattcgtacgccaaaacccc
gataccttaatggtgatcaccgccgaccataatactggcgggttatcgattggcgccgat
ggcaactacaactggaatccagagatcctacgtaatatctcggcaagctcagatacctta
gcccaagccgcccttggtggtgacacttggcaagccgacctatcccgcgggctaggcttt
gaattgaccgaagaagaagtgactaagttaaatgttgccagaatgcagggcctagaaacc
atggccgttgcaattcgccatgtgattgataagcgtaccgatacaggttggactaccggc
ggccacacgggaactgatgtgcaagtctttgccgcaggcccagcctctgagttgtttaac
ggtcatcaagacaacacagatatcgccaataagatttttagcctgttacctaagcctaaa
aaaccaaaagccaccgcacaggtatcgactccagcgccagcaccagaactagcaccagtg
cagtctcagggctaa

DBGET integrated database retrieval system