KEGG   Shewanella sp. MR-7: Shewmr7_3639Help
Entry
Shewmr7_3639      CDS       T00389                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
shm  Shewanella sp. MR-7
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Shewmr7_3639
Enzymes [BR:shm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Shewmr7_3639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4318475..4319173
Genome map
AA seq 232 aa AA seqDB search
MVDALTAKGIDHCVTPLLCVEATPPLPPDTSHPLADVDMVICISANAVSFADAAFKVDTA
QVKDWPSVPYFAVGHATWEALQEKGIEALEAPDDCQQTEGLLTLPALQHIQGKHITIIRG
VGGREALAEQLSARGAKVRYWEVYQRACPPLDGAAVSQQWRDFGIDTIVITSGEVLDNLI
NLVPKELFAWLRSCHIIVPSNRVEAQAHAFGITQVTNANAANSKAVLNALKL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggtcgatgccttaactgcaaagggtatcgaccactgcgttaccccactcctctgtgtt
gaggccacgcctccgctgccacctgacacttcacatcccctagccgatgtcgatatggtt
atctgtatcagcgccaatgcggtgagctttgctgatgctgcgtttaaagtcgatactgcc
caagttaaagactggccaagcgtgccttatttcgccgtgggtcatgcgacttgggaagcg
ctgcaagaaaagggaattgaggctctcgaagctccggatgattgccaacaaacggaaggc
ttgctgaccctgccagcactgcaacatatccaaggcaaacacatcactatcattcgtggc
gtcggtggccgtgaagccctcgccgagcaactgagtgccagaggtgcaaaggtgcgctat
tgggaagtctatcaacgcgcttgcccgccgctcgatggtgccgcggttagccaacaatgg
cgagactttgggatagatactatcgtcataacgagtggtgaagtactggataatctgatt
aatctagtgccaaaagagttatttgcatggctgcgctcatgtcatatcatagtccccagt
aaccgagtagaagctcaagctcatgcctttggtataacccaagtcaccaatgccaatgcc
gccaacagcaaagccgtgctaaacgcccttaaactctaa

DBGET integrated database retrieval system