KEGG   Shewanella sp. MR-7: Shewmr7_4006Help
Entry
Shewmr7_4006      CDS       T00389                                 

Definition
(GenBank) alpha/beta hydrolase fold
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Shewmr7_4006
Enzymes [BR:shm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Shewmr7_4006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 DLH Esterase Abhydrolase_5 Peptidase_S28 Esterase_phd PGAP1 Lipase_3 LIDHydrolase UPF0227
Motif
Other DBs
NCBI-ProteinID: ABI44983
JGI: Shewmr74006
UniProt: Q0HPH2
Position
4754769..4755782
Genome map
AA seq 337 aa AA seqDB search
MSQTPLNFPREEFSKVAFSTEHNLNTSEQQAFWQTVVQDTLKTSDGLTLAYMMVKHPKAH
ASIVISSGRVESYLKYQELVFDLYQQGYSVFAIDHRGQGLSSRMTATPHQGHVRRFNDYI
DDFALFMQTVVLKHATSPLFLLGHSMGGAIGTLYLKQHPDVFTAAAFSAPMYGIKLPMPK
GFVRWLASKLDASLNGGEPNYVLSGQNYKAAPFKGNDLTHCQSRYQAYRELYDAAPKLQL
GSPTNRWLTESLDAADACVLATAHIRTPILILQASEDKIVDNAAQNLAVSSNCQLKVIAG
AAHEIFMEKDSYRNQALNYALDFFKRYATRDVDKQAV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaacgcccctaaactttccaagggaagagttttccaaggtagctttttcaacg
gaacacaatttaaatacttctgaacagcaagccttctggcaaaccgttgtccaagacaca
ctcaaaacgtccgatggattaaccttggcctacatgatggtcaagcatcccaaggcccat
gccagcatagtcatcagtagtggccgggttgagtcctacttaaagtatcaagaactcgtt
tttgatttgtaccagcaaggctattcggtatttgctatcgatcaccgcggccagggatta
tcgagccgcatgacggccaccccccatcaaggccacgtgcgacgattcaacgactatatc
gacgactttgccctgtttatgcaaaccgttgtactcaaacatgccacttcgccactgttc
ttgctcgggcattctatgggcggcgctatcggcaccttgtatctcaaacaacatcccgat
gtgtttacggcggcagcattctccgcccccatgtacggcattaagttacctatgcccaaa
gggtttgtccgttggcttgcgagtaagctcgatgccagtctcaacggtggagagcctaac
tatgtcctcagcgggcaaaactataaggcagctccctttaagggcaatgatctcacccat
tgccagagtcgttatcaagcctaccgagagttgtacgatgcggcgccaaagctgcaatta
ggctcacccactaaccgctggttgactgaatccttagatgcggccgatgcctgtgtcttg
gccacagcacatatccgtacgcctattctgatcctgcaagccagtgaggataagatcgtc
gacaatgctgcacaaaatctggcggtaagctcaaattgccaattaaaggtgattgcaggg
gctgcccatgagatttttatggagaaagatagctaccgtaatcaagcgcttaattacgcg
ctcgacttttttaaacgctacgcaacaagggacgtggacaaacaagctgtttaa

DBGET integrated database retrieval system