KEGG   Shewanella sp. MR-7: Shewmr7_4006Help
Entry
Shewmr7_4006      CDS       T00389                                 

Definition
alpha/beta hydrolase fold domain-containing protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
shm  Shewanella sp. MR-7
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Shewmr7_4006
Enzymes [BR:shm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Shewmr7_4006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4754769..4755782
Genome map
AA seq 337 aa AA seqDB search
MSQTPLNFPREEFSKVAFSTEHNLNTSEQQAFWQTVVQDTLKTSDGLTLAYMMVKHPKAH
ASIVISSGRVESYLKYQELVFDLYQQGYSVFAIDHRGQGLSSRMTATPHQGHVRRFNDYI
DDFALFMQTVVLKHATSPLFLLGHSMGGAIGTLYLKQHPDVFTAAAFSAPMYGIKLPMPK
GFVRWLASKLDASLNGGEPNYVLSGQNYKAAPFKGNDLTHCQSRYQAYRELYDAAPKLQL
GSPTNRWLTESLDAADACVLATAHIRTPILILQASEDKIVDNAAQNLAVSSNCQLKVIAG
AAHEIFMEKDSYRNQALNYALDFFKRYATRDVDKQAV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaacgcccctaaactttccaagggaagagttttccaaggtagctttttcaacg
gaacacaatttaaatacttctgaacagcaagccttctggcaaaccgttgtccaagacaca
ctcaaaacgtccgatggattaaccttggcctacatgatggtcaagcatcccaaggcccat
gccagcatagtcatcagtagtggccgggttgagtcctacttaaagtatcaagaactcgtt
tttgatttgtaccagcaaggctattcggtatttgctatcgatcaccgcggccagggatta
tcgagccgcatgacggccaccccccatcaaggccacgtgcgacgattcaacgactatatc
gacgactttgccctgtttatgcaaaccgttgtactcaaacatgccacttcgccactgttc
ttgctcgggcattctatgggcggcgctatcggcaccttgtatctcaaacaacatcccgat
gtgtttacggcggcagcattctccgcccccatgtacggcattaagttacctatgcccaaa
gggtttgtccgttggcttgcgagtaagctcgatgccagtctcaacggtggagagcctaac
tatgtcctcagcgggcaaaactataaggcagctccctttaagggcaatgatctcacccat
tgccagagtcgttatcaagcctaccgagagttgtacgatgcggcgccaaagctgcaatta
ggctcacccactaaccgctggttgactgaatccttagatgcggccgatgcctgtgtcttg
gccacagcacatatccgtacgcctattctgatcctgcaagccagtgaggataagatcgtc
gacaatgctgcacaaaatctggcggtaagctcaaattgccaattaaaggtgattgcaggg
gctgcccatgagatttttatggagaaagatagctaccgtaatcaagcgcttaattacgcg
ctcgacttttttaaacgctacgcaacaagggacgtggacaaacaagctgtttaa

DBGET integrated database retrieval system