KEGG   Shewanella sp. ANA-3: Shewana3_0066Help
Entry
Shewana3_0066     CDS       T00428                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
shn  Shewanella sp. ANA-3
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:shn00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(76921..78405)
Genome map
AA seq 494 aa AA seqDB search
MKNQVQLITYVDRITGAGLKQLKALLDNELDGLFGGVHLLPFYYPIDGSDAGFDPIDHVQ
VDSRLGDWDDVKSIGEAFDIMADLIVNHMSAESPEFKDVLKHGKQSVYWDLFLTKDKVFP
EGLSEQDQKAIYRPRPGSCFSTYTLADGSTEEFWTTFTRNQIDIDVNSAAGKDYLNRVLA
RFNHSKVNLIRLDAAGYAIKKPGTSCFMIEESFEFVDKLAKQANELGMTTLAEIHSHHMT
QIDIAKRVDMVYDFALPPLILHTLFSQDCSALSHWLDMAPRNCITVLDTHDGIGIIDVGP
MDGLRGLLNEKQIDNLVETIHGNSQGESLQATGAAASNVDLYQINCTYYDALGQNDLDYL
MARAIQFFAPGIPQVYYTGLLAIPNDMTLLNQTHVGRDINRPYLNREKVQQALQKPVVKA
LIQLIKLRNNSAAFNGRFSMAASGKTLTLTWSAQNASASLSLDFAHKQGLITLLDEQGIE
TQIALADLLTQAQA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaagtgcaattgatcacctatgtcgatcggataaccggtgccggactcaaa
caactcaaagccttactcgataatgagttagatggtttatttgggggcgttcatctactg
ccattttactatcccatcgatggcagcgatgcagggtttgatcccatagaccatgtacaa
gtggactcacgcttaggtgattgggacgatgtcaaaagcataggcgaagcgttcgacatc
atggccgacttgatcgttaaccatatgtccgcagaatctcccgagtttaaagatgtgctc
aaacatggcaaacaatcggtttactgggatttattcctgaccaaggacaaggtattccca
gagggattaagtgaacaggatcaaaaagctatctatcgcccccgcccaggaagctgcttt
agcacttacaccttagcggatggttcaacggaagaattttggaccacctttacccgtaac
cagatcgatatcgatgttaactcagctgcaggtaaggattatttaaaccgcgtattggcg
cgatttaaccacagcaaagtcaatttaatccgcttagatgccgcaggttatgcgataaaa
aaacccggcactagctgctttatgattgaggaatccttcgagtttgtggataaattagcg
aaacaggccaatgagttaggtatgacaaccctagccgaaatccactcccatcatatgacg
caaatcgatatcgccaaacgagtggacatggtttacgacttcgccctgccaccgctcatc
ctgcacacgctgtttagccaagattgtagcgccctgagtcactggctagacatggcccct
cgcaactgcattaccgttctcgatacccacgatggcattggtattatcgatgtcggccca
atggatggcttacgcggattattgaacgaaaaacaaatcgataatctggtcgaaaccata
cacggcaacagtcaaggcgagagtctacaagccactggggcggccgccagcaatgtcgat
ttgtatcaaatcaactgcacctattacgatgccctagggcaaaatgatctagattacttg
atggcgcgagcaattcagtttttcgcaccgggtattcctcaggtctactacacaggcctg
cttgccataccaaacgacatgacgttgctgaatcaaacccacgtcggccgagacattaat
cgcccctatttaaaccgggaaaaagtgcaacaagccctgcaaaaacctgtggttaaagcc
ctcatccaattgattaaactgcgtaataatagcgcagcattcaatggccgcttttcgatg
gctgcaagtggaaaaacactaactctcacatggtctgcacaaaatgcatcggccagtctt
agtctcgactttgcccataaacaagggctgatcaccctacttgatgagcaaggcatcgaa
acccaaatcgcattagcagacctgctcactcaagcacaggcctaa

DBGET integrated database retrieval system