KEGG   Shewanella sp. ANA-3: Shewana3_0170Help
Entry
Shewana3_0170     CDS       T00428                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
shn  Shewanella sp. ANA-3
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Shewana3_0170
Enzymes [BR:shn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Shewana3_0170
Transfer RNA biogenesis [BR:shn03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Shewana3_0170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
203124..203936
Genome map
AA seq 270 aa AA seqDB search
MKPEELIDEVIAIATDAGRTIREIYLKGNFERETKSDNTPVTSADLAANQLICERLAALT
PDIPILSEEAADIPLSVREGWKRYWLVDPLDGTGEFIAGSGDFSVIIALVEHNRPVMGVV
YVPMTQVCYYAIAGLGAYKRTDKQEVRISSRQIQHREQVSLRLAVSRRQDPQSVLTLFNQ
PKHCELVVMGGAALKSCLVAEGRADCYVRVGPTGEWDTGAAQIIIEEAGGQLMDTELQPL
TYNERETLENPNFIVVGAPNLEWDKILIGE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaagccagaagagttaatcgacgaggtgattgcgatagcaacggatgcgggtcgcact
attcgtgagatttacctcaagggtaattttgaacgagaaaccaagtctgataatacccct
gtcacctcggcggacctagcggcgaatcagctgatttgtgagcgcttagccgcattgaca
cccgatattcctatcctgtccgaagaggctgccgatattcccctaagcgtgcgcgaaggc
tggaaacgttattggttagtcgatcctctcgatggcacgggggagtttattgcgggcagt
ggtgacttttcggtgatcatcgcgctggtggagcacaatcgtccggtaatgggtgttgtg
tatgtgccgatgacgcaggtgtgttattacgccattgcgggcttaggcgcctataaacgc
accgataagcaggaagtgcgtatcagtagtcggcaaattcagcatcgtgagcaagtttct
cttaggttagctgtgagtcgtcgtcaggatccccaatccgtgttgaccctgttcaatcag
cctaagcattgtgagttggtggtcatgggcggtgcggccctgaagagttgtctggttgcc
gaagggcgcgccgattgctatgtgcgagtcgggccaacgggggagtgggacaccggtgcc
gcgcagatcattattgaggaagcgggtggccagctcatggataccgagctgcaaccttta
acctacaacgagcgtgagacgcttgaaaatcctaactttattgttgttggtgcgcccaat
ttagagtgggataaaattttaattggtgaatag

DBGET integrated database retrieval system