KEGG   Shewanella sp. ANA-3: Shewana3_0236Help
Entry
Shewana3_0236     CDS       T00428                                 

Definition
cytochrome C biogenesis protein
Orthology
K02200  
cytochrome c-type biogenesis protein CcmH
Organism
shn  Shewanella sp. ANA-3
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
265777..266256
Genome map
AA seq 159 aa AA seqDB search
MRTLTKIIGGLVLLLSMATAAMATPVDTYEFKSPENQKRGLSLAHELRCPQCQNQNLIDS
NSPVARDLRLEVYKMVDEGKGDDEIIEFMTSRYGEFVLYKPKMETKTYILWLGPVGLLLL
GLIIGFIFIRKQRIGGCTEAEISAEDQKALDALLKRDTK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgagaacactgacaaaaatcatcggtggtttagtgttgttgctgagtatggcaacagcg
gccatggcgacacccgtcgatacttacgagtttaaatcgccagaaaaccaaaaacgtggt
ttatcgctggcccatgaactgcgttgtccgcaatgtcaaaaccaaaacctgatcgactct
aactcacccgttgcccgagatctgcgtcttgaagtctacaagatggttgatgaaggcaag
ggcgatgatgagatcatcgagtttatgacgagccgctatggtgagttcgttctctacaaa
cctaaaatggaaaccaaaacctatattctttggttaggtccagtgggtttgttgctgctc
ggtctgatcattggcttcatctttatccgcaagcaacgtatcggtggctgcactgaggcc
gagatcagcgccgaagatcaaaaagcgctcgatgctttattaaagcgtgatactaaatga

DBGET integrated database retrieval system