KEGG   Shewanella sp. ANA-3: Shewana3_0766Help
Entry
Shewana3_0766     CDS       T00428                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
shn  Shewanella sp. ANA-3
Pathway
shn00900  Terpenoid backbone biosynthesis
shn01100  Metabolic pathways
shn01110  Biosynthesis of secondary metabolites
shn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Shewana3_0766
Enzymes [BR:shn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Shewana3_0766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C SPOR
Motif
Other DBs
NCBI-ProteinID: ABK47004
JGI: Shewana30766
UniProt: A0KT85
Position
complement(888596..889450)
Genome map
AA seq 284 aa AA seqDB search
MSNEISRNWPAPAKLNLFLHINGRRADGYHELQTLFQFIDCCDQLDFRVTQTPELILHSN
MSAVVADSDNLILRAAKSLQQATSYPGGAEIWLEKRLPMGGGLGGGSSDAATTLVALNQL
WNTQLSNDELAAIGLKLGADIPVFIRGFAAFAEGVGERLQAVTPTEFWYLVIAPDAHVST
AAVFQDPLLPRNTPKLGIDTLMSQPWANDCQDLVVSKYPQVAKALGWLLEYAPSRMTGTG
ACVFGEFSSQQQALAALAKLPSDMQGFVAKGMNISPLIVRLTHP
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatgagatttcacgcaactggcccgcgcccgccaaattaaatctgtttttgcat
atcaacgggcgccgcgccgacggttaccatgagttgcaaaccctgtttcaatttatcgat
tgttgcgatcaactcgattttagggtgacgcagacgcctgagctgatattgcactcgaac
atgtcggccgttgtcgccgatagcgataacttaattctgcgagccgcaaaatcattacag
caagcgacaagttatcctggcggcgccgaaatctggctcgaaaaacgtttacccatgggc
ggtggtttaggtggcggctcctccgatgcggccaccacactcgtggccttaaatcagttg
tggaacacccaattatctaacgatgaattagcggcgattggtttaaaactcggtgccgat
atccctgtttttattcgcggtttcgcggcatttgccgaaggcgttggcgaacgtttacag
gcggtgacgcccactgaattttggtatttagtgatagcgcccgatgcccatgtctccacc
gctgcggtgttccaagatcctttgctaccccgcaatacacctaagcttggcatcgacacc
ttaatgagccaaccttgggcaaatgattgccaagatctggtcgtttccaaataccctcaa
gttgccaaggccttaggctggctgctagaatatgcgccgtcgagaatgaccggaacgggc
gcatgcgtgtttggggagttttcttcgcagcagcaagctctcgcagccttggcgaaatta
ccgtctgatatgcaaggatttgttgcaaaagggatgaatatttcgccgctcatagtgcga
ctcactcatccataa

DBGET integrated database retrieval system