KEGG   Shewanella sp. ANA-3: Shewana3_1026Help
Entry
Shewana3_1026     CDS       T00428                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
shn  Shewanella sp. ANA-3
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Shewana3_1026
   01230 Biosynthesis of amino acids
    Shewana3_1026
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shewana3_1026
   00051 Fructose and mannose metabolism
    Shewana3_1026
   00562 Inositol phosphate metabolism
    Shewana3_1026
Enzymes [BR:shn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Shewana3_1026
Exosome [BR:shn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Shewana3_1026
  Exosomal proteins of bladder cancer cells
   Shewana3_1026
  Exosomal proteins of melanoma cells
   Shewana3_1026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1198659..1199441
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAGNWKMNGSAALAQELFKKFASKLQNDSAEVVLCPPSIYLESVRQLLEANKE
ALDGSLVRMGAQNLSQHDFGAYTGEVSGQMLKDCGCRYVIIGHSERRRMYGETSNIVAEK
FAAAQKHGLTPILCVGESGPAREARRTFEVIAEELDIVIQKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRKRLSEVSPFIGENIRILYGGSVTPSNAADLFAQPDVDGGLI
GGASLNSTEFLSLCTIAMSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagacgtcctatggtagctggcaattggaagatgaacggcagcgcggcatta
gcccaagagttgttcaagaaatttgcctcaaagctccaaaatgattcagctgaagtggtt
ttatgcccgccttctatctatctagaaagcgtaaggcaactgctagaagcaaacaaggaa
gcgttagacggttcacttgttaggatgggcgctcagaatttaagtcaacatgactttggc
gcttataccggagaagtttcgggtcagatgcttaaagattgcggatgtcgatatgtcatt
atcgggcattcagaacgtcgccgtatgtacggagagacgagtaatatcgtagcggagaaa
ttcgctgcagcacaaaagcacggtttaacccccattttatgcgtgggtgagtcgggtcca
gcacgtgaagcaagacgtaccttcgaggtgattgcggaagagttggatatagtgatccag
aaaaatggcactatggcttttgataacgccattatcgcttacgagccgttatgggcggta
gggactggtaagagcgcgacaccagagcaggcacaagaagtacatgcgtttatacgcaag
cgtctctctgaagtgtctccgtttatcggagaaaatatcaggattttgtacggtggcagt
gtgacaccgagtaatgcggcagatttatttgcccaacctgatgttgatggtggactgatt
ggcggtgccagtttaaactctaccgagtttttaagtctgtgtaccatagcgatgagcgca
taa

DBGET integrated database retrieval system