KEGG   Shewanella sp. ANA-3: Shewana3_1392Help
Entry
Shewana3_1392     CDS       T00428                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
shn  Shewanella sp. ANA-3
Pathway
shn00521  Streptomycin biosynthesis
shn00523  Polyketide sugar unit biosynthesis
shn01130  Biosynthesis of antibiotics
Module
shn_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Shewana3_1392
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Shewana3_1392
Enzymes [BR:shn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Shewana3_1392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABK47626
JGI: Shewana31392
UniProt: A0KV07
Position
1607096..1607632
Genome map
AA seq 178 aa AA seqDB search
MKCIETELAEVLVFEPQVFGDERGFFMETFRQSFFSECLKSRGLKVQELVQDNFSRSQQH
VLRGLHYQREHPQGKLVRVCAGSIFDVAVDIRPQSKTYGKWVGRVLSADNHLQMWIPPSF
AHGFYVLSEYADVLYRCTDYYAPDDEYVLAWNSAEFAIDWPLLNETPILSERDAAASA
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgcattgaaaccgagcttgcagaagtattggtgttcgaacctcaagtttttggt
gatgaacgcggtttttttatggaaacctttagacaatcgtttttctccgagtgtttgaaa
agtagaggattaaaggtgcaggagttagtccaagataactttagccgatcacaacaacac
gtattacgtggcttgcactaccaacgtgagcatccgcagggaaagttagttcgcgtgtgt
gctggcagtatttttgatgtcgctgtggatattcgcccgcaatctaaaacctatggtaaa
tgggtagggcgtgtgctctctgctgataaccatttgcaaatgtggatcccgcctagcttt
gctcatggattttatgtgttgagtgaatatgccgatgtgctttatcgctgcactgattat
tacgcgccagatgatgaatatgtgctggcatggaatagtgccgagtttgcgattgactgg
ccgctgctaaatgaaacgccgattctgtctgaaagggatgctgccgctagcgcctaa

DBGET integrated database retrieval system