KEGG   Shewanella sp. ANA-3: Shewana3_1461Help
Entry
Shewana3_1461     CDS       T00428                                 

Gene name
fadJ
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
shn  Shewanella sp. ANA-3
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Shewana3_1461 (fadJ)
   01212 Fatty acid metabolism
    Shewana3_1461 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Shewana3_1461 (fadJ)
   00650 Butanoate metabolism
    Shewana3_1461 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    Shewana3_1461 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    Shewana3_1461 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Shewana3_1461 (fadJ)
   00310 Lysine degradation
    Shewana3_1461 (fadJ)
   00380 Tryptophan metabolism
    Shewana3_1461 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Shewana3_1461 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Shewana3_1461 (fadJ)
   00281 Geraniol degradation
    Shewana3_1461 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Shewana3_1461 (fadJ)
Enzymes [BR:shn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Shewana3_1461 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Shewana3_1461 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Shewana3_1461 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1694533..1696662
Genome map
AA seq 709 aa AA seqDB search
MEKTFNLTRREDGIAILMMDVPGETMNTLKAEFGPEISEILSEIKRDSSIRGLVLISGKK
DSFVAGADISMLDACQTAGDAKALSQQGHVVFNELEALNIPVVAAIHGACLGGGLELALA
CHQRVCSDDGKTMLGVPEVQLGLLPGGGGTQRLPRLVGITTALDMMLTGKQIRPKQALKM
GLVNDVVPQTILLQTAVEMALAGKRTAKPVKKSLVNQLLEGTGFGRNIIFDQAAKQVVKK
TQGNYPAPAKIIDCVRQGMAKGMQKGLEVEASHFAELVVSKESEALRSIFFATTEMKKET
GAEGATPRKVKKAVILGGGLMGGGIASVTTTKAKIPARVKDINEKGLSNALSYAYKLLDK
GVKRRHMTPAVRDNLMALMTTTTEYKGVKDADIVVEAVFEDLALKHQMVKDIERECGEHT
IFASNTSSLPIGQIAQAASRPENVIGLHYFSPVEKMPLVEVIAHAKTSPETIATTVAFAR
KQGKTPIVVQDGAGFYVNRILALYMNEAAQLLLEGQSIEHLDKALVKFGFPVGPITLLDE
VGIDVGAKIAPILEKELGERFKAPAAFDKLLSDDRKGRKNGKGFYQYAAGNKASSKKKAV
DESVYAVLGIKPGMDKDLSAVAERCVVQMLNEAVRCLDDGIIASPRDGDIGAIFGIGFPP
FLGGPFHYIDTLGADNLVNILERYQAQYGDRFEPCPRLKAMAAEKARFF
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagacatttaatttaacccgccgtgaagacggtatcgccattctaatgatggac
gtacccggcgaaaccatgaataccctcaaggcagagtttggccctgagatcagtgagatc
ctgtctgagattaaacgcgatagcagtatccgtggcctagtgctgatttcgggtaaaaaa
gactccttcgtagctggggcggatatttctatgctcgacgcttgccaaacggcgggcgat
gcgaaagccttatcccagcaagggcatgtggtgtttaacgagttagaagccttgaatatc
cctgtggttgccgcgatacatggcgcctgtttagggggcggtcttgagcttgcgcttgcc
tgccatcaacgtgtgtgcagtgatgacggcaagaccatgttgggcgtacccgaagtgcaa
ctcggtttgttacccggtggcggcggtactcagcgtttgcctcgtttagtggggatcact
actgcgctggatatgatgttgacgggtaaacaaattcgtcctaaacaagcgttaaagatg
ggcttagttaacgatgtggtgccacagacaattttactgcaaaccgcagtggagatggcg
ctcgcgggtaagcgcacggcgaaaccagttaaaaaatctctggttaatcaattactcgaa
ggcacagggtttggtcgtaacattattttcgatcaagctgccaagcaagtcgttaagaaa
acccaaggtaactatcctgcaccagcaaaaattattgattgcgtgcgccaaggtatggcg
aagggaatgcagaaagggcttgaggtggaagccagccattttgctgagctggtggtgtcg
aaagaatctgaggcgctgcgcagtattttctttgccactacagagatgaagaaagaaact
ggcgccgaaggggcgacaccacgtaaagtcaaaaaagccgtgatcttaggtggcggtttg
atgggcggtggtattgcttcggtcacgacgactaaggcgaaaattcctgcgcgggtaaaa
gacattaacgaaaagggcttaagcaatgcgctttcttacgcctataagttattggataaa
ggcgttaaacgtcgtcatatgacgccggccgttcgcgacaatttaatggcactgatgaca
acgacgaccgaatataaaggcgttaaggacgctgatattgttgttgaagccgtatttgag
gatttagcgcttaaacatcagatggttaaagatattgagcgtgaatgcggcgagcacacg
atttttgcatctaacacctcatctttacccattggccaaattgcacaggcggccagccgt
cctgaaaatgtgattggcttacattatttctcaccagtagaaaaaatgccgctggtggaa
gtgattgcccatgcgaaaacgtctcctgagacgattgccaccacagtggcctttgcccgc
aaacagggtaaaacgccaatcgtggtacaagacggtgccggtttttatgttaaccgtatc
ctcgcgctgtatatgaacgaagctgcacaattactgctggaaggccagagtattgagcac
ttagacaaagccttagtgaagttcggtttccccgttggccctatcactttgctcgatgaa
gtgggtatcgatgtcggtgctaaaatcgctccaatccttgaaaaagaactgggcgagcgc
tttaaagccccagcagccttcgataagttactgagcgatgatagaaaaggccgtaaaaat
ggcaaaggtttctatcaatatgctgctggcaataaagcgtcgagcaagaagaaagccgtg
gatgaaagtgtttacgcagtacttggcatcaagccaggtatggacaaagacttaagtgct
gtggccgagcgttgtgtggtgcaaatgctcaatgaagcagtacgttgtttagatgacggc
attattgcttccccgcgtgatggtgatattggcgccattttcggtattggtttcccacca
ttcttaggtggcccattccactatattgataccctaggtgccgataacttggtcaacata
ctggaacgttatcaagctcaatacggcgaccgatttgagccatgcccacgtcttaaggcg
atggcggcagaaaaggctcgtttcttctaa

DBGET integrated database retrieval system