KEGG   Shewanella sp. ANA-3: Shewana3_1537Help
Entry
Shewana3_1537     CDS       T00428                                 

Definition
GDSL family lipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
shn  Shewanella sp. ANA-3
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:shn01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1793137..1793736)
Genome map
AA seq 199 aa AA seqDB search
MAKAVSACILLSLFITTPVQAAKVLILGDSLGASYGMSEQVGWVALLQKNLPEHEFTNGS
VSGETTAGGLRRLPALLDSVAPDLVVVELGGNDGLRGFPPTQLKNNLIQIITLAKNSGAK
VLLTEIMVPPNYGPRYTQKFTQVYQEIAKDEEIALIPFFMQDIAPHPELMQRDGIHPNEK
AQEKIATWMQPWIEKALTQ
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggccgtgagcgcctgcatcctgttaagtctgtttataaccacgccagttcag
gcggcgaaagtgttgatcctcggcgatagcttaggtgccagctatggcatgtcggaacaa
gtaggctgggtggcgctgctgcaaaaaaatttacccgagcatgaatttaccaatggttcg
gtgagcggtgaaaccacagcgggcggtttgcgtcgtttgcctgcgctgctcgattccgtg
gcccccgatttggtggtggtcgaactcggtggtaacgatggtttacgtggattccccccg
acgcaactcaaaaataacctaatccaaatcattaccctagctaaaaatagcggtgctaaa
gtgctactgaccgaaatcatggtaccgcctaactatggccctcgctatacccaaaagttc
acccaagtgtatcaagagattgctaaagacgaggagattgcattaattcccttctttatg
caggacattgctccccaccctgagttaatgcaaagggacggaattcatcccaatgaaaag
gcccaagagaagatcgctacttggatgcaaccttggattgaaaaagcattaactcaataa

DBGET integrated database retrieval system