KEGG   Shewanella sp. ANA-3: Shewana3_1707Help
Entry
Shewana3_1707     CDS       T00428                                 

Definition
succinate dehydrogenase subunit D (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
shn  Shewanella sp. ANA-3
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Shewana3_1707
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Shewana3_1707
   00650 Butanoate metabolism
    Shewana3_1707
  Energy metabolism
   00190 Oxidative phosphorylation
    Shewana3_1707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2009604..2009951
Genome map
AA seq 115 aa AA seqDB search
MVTNAASFGRSGVHDFILLRASAVILACYTIFMVGFIACSSPLTYDVWHGLFSALPMKVF
TLLALVALLVHAWIGVWQVLTDYVKCTSLRGVLQFTFVVTVFCYLAAGIVIVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaatgcagcaagttttggacgcagtggtgttcatgactttattctactacgc
gctagtgcagtaatcctcgcctgttacaccattttcatggttggctttattgcatgtagt
tcccctctcacctatgacgtttggcacggcctgtttagcgctctgccaatgaaagtgttt
accctgcttgcgctagttgcactgcttgttcacgcctggattggtgtatggcaagtattg
acggattacgtcaagtgcacttcgttacgcggtgttttacagttcaccttcgtcgtcacc
gtcttttgttatctggcggccggcattgttattgtgtggggtgtctaa

DBGET integrated database retrieval system