KEGG   Shewanella sp. ANA-3: Shewana3_1711Help
Entry
Shewana3_1711     CDS       T00428                                 

Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
shn  Shewanella sp. ANA-3
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Shewana3_1711
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Shewana3_1711
  Amino acid metabolism
   00310 Lysine degradation
    Shewana3_1711
Enzymes [BR:shn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Shewana3_1711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2015520..2016713
Genome map
AA seq 397 aa AA seqDB search
MSIEIKVPVLPESVADATIATWHVKVGEQVSRDQNLVDIETDKVVLEVVAPEDGHIGEFL
FQEGDTVLGEQVIAKFIAGAVSGQEVTKAEAEAAAPVAAAATEESNDALSPSVRRLLAEH
NVDASKVKGTGVGGRITKEDVEAFIKSAPKAAAPAAPAVQPLAAGRSEKRVPMTRLRKTI
ANRLLEAKNSTAMLTTFNEVNMKPIMDIRKQYQDIFEKRHGIRLGFMSFYVKAVTEALKR
FPEVNASIDGDDIVYHNYFDVSIAVSTPRGLVTPVLRDTDTMSLADIEKAVRDLAIKGRD
GKLTVADMTGGNFTVTNGGVFGSLMSTPILNLPQSAILGMHAIKDRPMAVNGQVEILPMM
YLALSYDHRIVDGRESVGFLVAIKDFLEDPTRLLLDL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaaatcaaggtacccgtactgccagaatctgttgccgatgcaactatcgcc
acttggcacgtaaaagtgggtgagcaagtttctcgtgatcaaaatctggttgatattgaa
actgacaaagtcgtactggaagtggttgcaccagaagatggtcacatcggtgagttcctg
ttccaagaaggcgacaccgttctgggcgagcaagtgattgctaagttcatcgcgggtgcg
gtttctggtcaagaagtgactaaagccgaagctgaagctgctgcacctgttgccgctgct
gcaactgaagagtctaacgatgcattaagcccatcagtacgtcgtttactggctgagcac
aatgttgatgcgagcaaagtgaagggcactggtgtcggtggccgtatcactaaagaagac
gttgaagcctttatcaagtctgcgcctaaagctgctgcccctgcggctcctgcggtacaa
ccactcgctgcgggtcgtagcgagaaacgtgttccaatgactcgtttacgtaagactatc
gctaaccgtttattagaagcgaaaaactctactgcaatgctcacgacgttcaacgaagtg
aacatgaagccaatcatggatatccgtaagcaatatcaagatatctttgaaaagcgccac
ggtatccgtttaggtttcatgtctttctacgtgaaagcggtaaccgaagcgctgaaacgc
ttcccagaagtaaacgcgtcaatcgacggtgatgatattgtttaccacaactacttcgac
gtcagcatcgcggtatcgactcctcgtggtctggtcactccagtattgcgtgataccgat
actatgagcctagctgatatcgaaaaagcagtccgcgatctggcgatcaaaggccgtgat
ggcaagctgactgtggctgatatgactggcggtaacttcacagtgactaacggtggtgta
ttcggctcgttaatgtctaccccaattttaaacctgccacaaagcgcgattttaggcatg
cacgccattaaagaccgcccaatggcagtcaatggtcaggttgaaatcctgcccatgatg
tacctagctctctcatatgaccatcgtattgtcgatggccgtgagtcagttggcttctta
gtcgccattaaagacttcttggaagacccaactcgtctgctacttgacctataa

DBGET integrated database retrieval system