KEGG   Shewanella sp. ANA-3: Shewana3_1712Help
Entry
Shewana3_1712     CDS       T00428                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
shn  Shewanella sp. ANA-3
Pathway
shn00020  Citrate cycle (TCA cycle)
shn00640  Propanoate metabolism
shn00660  C5-Branched dibasic acid metabolism
shn01100  Metabolic pathways
shn01110  Biosynthesis of secondary metabolites
shn01120  Microbial metabolism in diverse environments
shn01130  Biosynthesis of antibiotics
shn01200  Carbon metabolism
Module
shn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
shn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Shewana3_1712
   00640 Propanoate metabolism
    Shewana3_1712
   00660 C5-Branched dibasic acid metabolism
    Shewana3_1712
Enzymes [BR:shn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Shewana3_1712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABK47945
JGI: Shewana31712
UniProt: A0KVX6
Position
2016832..2017998
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKSLFAEYGLPVSEGFACDTAQEAVEAAGRIGGNLWVVKCQVHAGGRGKAGGV
KVTGDKEEIRAFAEHWLGKNLVTYQTDEKGQPVAKILVESCTDIANELYLGAVVDRATRR
VVFMASTEGGVEIEKVAEETPELIHKAIIDPLTGPQPYQARDLGFKLGLNPTQMKQFTKI
FMGLATMFVDHDFALLEINPLVITTEGNLHCLDGKIGIDGNALFRQAKIKAMHDPSQDDA
REAHAAMFELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDSNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGTNAELGREV
LAKSGLDIIAANSLTDAAEQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgagtatcaggcaaaatccctatttgccgaatatggtttaccagtgtca
gaaggttttgcatgtgatacagcccaagaagctgtagaagcggcaggccgtattggcgga
aatttatgggttgttaagtgtcaagtacacgcaggcggccgcggtaaagcgggtggcgtt
aaagtcactggcgataaagaagaaatcagagcctttgccgaacactggttaggcaaaaat
ctggtgacttatcaaactgatgagaaaggtcagccggttgctaaaattttagtagaaagc
tgcactgacatcgctaacgaactgtacttaggtgcagtagttgaccgcgctacccgtcgc
gtagtgtttatggcgtcaactgaaggtggtgttgagattgagaaagtggccgaagaaacg
ccagaactcattcacaaagcgatcatcgatccactgactggtcctcaaccataccaagca
cgtgatcttggcttcaaactgggcttaaacccaactcaaatgaagcaattcaccaagatc
ttcatgggtctggcgactatgttcgttgatcacgatttcgctctgctggaaatcaaccca
ctggttatcaccactgaaggtaacctgcactgcttagacggtaaaattggtatcgatggt
aacgcactgttccgtcaagcaaaaatcaaagcaatgcacgatccatctcaagatgacgcc
cgtgaagctcacgctgcaatgttcgaactgaactatgttgcgctagacggaaacgtaggt
tgtatggtgaacggtgctggcctagcgatgggtactatggacatcgttaacctgcacggc
ggcaagccagctaacttcctcgacgtaggtggtggcgcgactaaagaacgtgttgctgaa
gcattcaagatcattctgtctgacagcaatgtgaaagccgttctagttaacatcttcggt
ggtatcgtacgttgtgacatgatcgcagaaggtatcattggcgctgttaaagaagttggc
gttaaagttccagttgtagtgcgtttagaaggtactaacgctgaattaggccgtgaagta
ttagctaaatcaggtcttgatatcattgcagctaacagtctgactgatgcggctgagcaa
gtagttaaagctgcggagggcaaataa

DBGET integrated database retrieval system