KEGG   Shewanella sp. ANA-3: Shewana3_1788Help
Entry
Shewana3_1788     CDS       T00428                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
shn  Shewanella sp. ANA-3
Pathway
shn00010  Glycolysis / Gluconeogenesis
shn00071  Fatty acid degradation
shn00350  Tyrosine metabolism
shn00620  Pyruvate metabolism
shn00625  Chloroalkane and chloroalkene degradation
shn00626  Naphthalene degradation
shn00650  Butanoate metabolism
shn01100  Metabolic pathways
shn01110  Biosynthesis of secondary metabolites
shn01120  Microbial metabolism in diverse environments
shn01130  Biosynthesis of antibiotics
shn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shewana3_1788
   00620 Pyruvate metabolism
    Shewana3_1788
   00650 Butanoate metabolism
    Shewana3_1788
  Lipid metabolism
   00071 Fatty acid degradation
    Shewana3_1788
  Amino acid metabolism
   00350 Tyrosine metabolism
    Shewana3_1788
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Shewana3_1788
   00626 Naphthalene degradation
    Shewana3_1788
Enzymes [BR:shn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Shewana3_1788
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Shewana3_1788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ABK48021
JGI: Shewana31788
UniProt: A0KW52
Position
complement(2112522..2115122)
Genome map
AA seq 866 aa AA seqDB search
MTVTNAQELDLMVERVAKAQAEYASFSQAQVDAIFRAAALAAADARISLAKMAAAETRMG
VIEDKVIKNHFASEYIYNKYKDEKTCGILSEDPTFGTITIAEPVGIICGIVPTTNPTSTA
IFKALISLKTRNAIIFSPHPRAKVSTTTAAKLVLDAAIAAGAPKDIIGWIDEPSVALSNQ
LMTHPKVNLILATGGPGMVKAAYSSGKPAIGVGAGNTPIVIDETADIKRAVSSILMSKTF
DNGVVCASEQAVIVVDSIYEQVKERFATHGGYLLNAAQTAAMQQVILKNGGLNADIVGQS
AATIAQMAGIDVPYTTKVLIGEVTDITEAEAFAHEKLSPLLGMYRAADFNDAFDKAEALV
ALGGIGHTSGLYTDQDTQTERVKTFGFRMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPSHLINKKTVAKRAENMLWHKLPSSIYFRRGSLPIALEELSDKRRA
LVVTDRFLFNQGYCDETLKILKAQGLETEVFYEVEADPTLATVRQGAKVANSFKPDVIIA
LGGGSPMDAAKIIWVMYEHPDVDFADLALRFMDIRKRIYKFPKMGVKATMVAIPTTSGTG
SEVTPFAVVTDEQTGKKYPIADYQLTPNMAIVDPNLVMDMPKSLTAFGGIDAITHALEAY
VSVMANEYSDGQALQALDLLCKYLPDAYQLGGASPIAREKVHNGATIAGIAFANAFLGIC
HSMAHKLGAEFHLAHGLANALLISNVIRFNATDLPTKQAAFSQYDRPKALCRYAAIADHL
ALDGNSDAEKVEKLLEKIEQLKKTLGIPASIQEAGVNEADFLAKLDELAEDAFDDQCTGA
NPRYPLISELKQLLLDSYYGRPFTEQ
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atgacagtaaccaatgctcaagaactggatctcatggtcgagcgcgtcgccaaagcgcaa
gccgaatatgccagttttagccaagcccaagtcgatgccattttccgcgccgcagctttg
gccgccgccgatgcacgtatatcgctcgcgaaaatggccgcagccgaaacccgaatgggg
gtgattgaagacaaagtgattaaaaaccactttgcttccgagtacatttacaacaagtat
aaagatgaaaagacctgcgggattttatctgaggacccgaccttcggcactatcacaatc
gccgagccagtgggcattatctgtgggattgttcccaccacgaatcccacctccaccgcc
atcttcaaagcgttgataagccttaaaacccgcaatgcgattattttctcccctcaccca
agggcaaaagtctcgaccaccacagcggccaaactggtgctagatgccgccattgccgcc
ggtgcgcccaaggacattatcggttggattgatgagcccagtgtggcactttccaaccaa
ttgatgacccaccctaaagtgaaccttatcctcgccacaggtggcccaggaatggtgaaa
gccgcctactcctccggcaaacccgccattggcgtgggtgcgggtaacacgccaattgtg
attgatgaaaccgccgatataaaacgcgcggtcagctcgattctgatgtctaaaaccttc
gataacggtgttgtctgtgcctcagagcaagcggtgattgtagtcgatagtatctacgaa
caagttaaagagcgcttcgcgacccacggtggttatctcttaaatgcagcgcaaaccgct
gcaatgcaacaagttatccttaaaaatggcggcttaaatgccgatatcgtcggccaaagc
gccgcgaccatagcgcaaatggcgggcattgatgtcccctacactaccaaggtcttgatt
ggtgaagtcacggatatcactgaggccgaagcctttgcccacgaaaaactctctccttta
cttggcatgtaccgcgccgccgatttcaatgacgccttcgataaagccgaagccttagtt
gccttaggcggcattggccacacatccggcttatatactgaccaagacacccaaaccgag
cgggtgaaaacctttggttttagaatgaaaaccgcgcgaattctaatcaatactccagca
tcacaaggcggaattggcgatttgtacaactttaaactcgctccctcgctcaccttaggc
tgcggctcttggggcggaaactcgatttctgaaaacgtcggtccaagccatttaatcaat
aagaaaaccgtcgctaagagggctgaaaatatgctgtggcacaagcttccttcgtctatc
tacttccgccgcggcagtttacccatcgcccttgaagaattgagcgataaaagacgcgcc
ctcgtagtgaccgacagattcctgtttaaccaaggttattgcgacgaaaccttaaagatt
ttaaaagcccagggtcttgaaaccgaagtcttttacgaggtggaagccgatcccacactg
gccacagtgcgccaaggtgccaaagtcgccaatagctttaaacccgatgtgattatcgcc
ttaggcggtggctcgcccatggatgcggccaagattatttgggtgatgtacgagcatccc
gatgtcgattttgccgatttagccctgcgctttatggatatccgtaaacgtatctataaa
ttccctaaaatgggcgtcaaagccactatggtggcaatccccaccacatccggcacaggc
tcagaggtcacaccttttgccgtggtgaccgatgaacaaaccggtaaaaagtaccccatc
gccgactatcaactcaccccaaacatggcgattgttgacccgaatctggtgatggatatg
ccgaaatccttaaccgctttcggcggaattgatgcaatcacccacgcactcgaagcctat
gtcagcgtaatggcgaatgagtacagcgatggtcaagccctgcaagcacttgacctactg
tgcaaatatttacccgatgcttatcagcttggcggcgcatcccctatcgcccgtgaaaaa
gtgcacaatggcgcgactatagctggtatcgcctttgccaacgcctttcttgggatctgt
cactctatggcccataaactgggcgccgagtttcacttagcccatgggctggccaatgcg
ctactcattagtaacgtgatccgctttaatgcgaccgacttacccactaagcaagccgca
ttcagccaatacgacagacccaaagccctctgtcgctacgcggccattgccgatcattta
gccttagatggaaactcagatgcggaaaaagtcgagaaattgctggaaaaaatcgagcaa
ctcaagaagacgctgggcattccagcatctatccaagaagcgggagttaacgaagccgac
ttcctcgccaaactagacgagctcgccgaggatgccttcgatgatcaatgtactggcgcc
aaccctcgctaccccttgattagtgagctaaaacagctactgctcgacagctactatggc
cgccccttcaccgagcaatag

DBGET integrated database retrieval system