KEGG   Shewanella sp. ANA-3: Shewana3_2072Help
Entry
Shewana3_2072     CDS       T00428                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
shn  Shewanella sp. ANA-3
Pathway
shn00010  Glycolysis / Gluconeogenesis
shn00052  Galactose metabolism
shn01100  Metabolic pathways
shn01110  Biosynthesis of secondary metabolites
shn01120  Microbial metabolism in diverse environments
shn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shewana3_2072
   00052 Galactose metabolism
    Shewana3_2072
Enzymes [BR:shn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Shewana3_2072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABK48302
JGI: Shewana32072
UniProt: A0KWY3
Position
2480124..2481179
Genome map
AA seq 351 aa AA seqDB search
MQLSVTQKSLQHAAFADELQLVTLTNSHGLEVVLSNYGASIWSVKLYGQAQEPISLSLGY
QDIKDWVTNPYYFGITAGRVANRIGKAQFPLAGKTIQLVANEGNNQLHGGPKGLSHCTWQ
VEMLQDNDSVAAVFSITSPDGDQGFPGNLAITLEYRLNENNELTLNYQAVCDQTTPVCLT
NHAYWNLASNKQQGILGHELSIQASHFLALDNEQIPTGELILVDDGAYDFKQPKLIATDI
KQLTNGYDHYFVMDRNPDNKNSLQTIAVLKDPLSGRELEISTTEVGVQFYSGNFLDGSHI
DDEGYSINQFHGLCLETHGYPNAVNIDHFPSVMLEANTQYQQITVHKFKNI
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcaactctctgttactcaaaaaagcctacaacacgccgcatttgcggatgaactacaa
ttagtcacgctcactaatagccacgggcttgaagtggttctgtcaaattacggcgccagt
atttggtcggtcaaactttatggtcaagcgcaagaacctatttcattaagtctgggctat
caagatattaaagattgggtgactaatccgtattattttggtattaccgccggccgtgtc
gcaaatcgcattggtaaagcacaattccccttagcaggtaaaacaattcaattagtcgcc
aatgaaggcaataatcaacttcacggcggacctaaaggattaagccattgcacttggcag
gttgagatgctgcaggacaatgacagtgtggcggcggttttcagcattaccagccccgat
ggcgatcaaggatttccggggaatcttgcgattacgctcgagtaccgcctcaatgaaaac
aatgaattaactctgaactatcaagccgtttgcgatcaaaccacacccgtctgtttaact
aatcatgcttactggaatcttgcctccaacaaacagcaaggcattttagggcacgaactc
tccattcaagccagtcatttcttggcgctcgataatgaacagatcccgacgggcgaatta
atcttagtcgacgatggcgcatacgatttcaaacaaccgaagctaattgccacggatatt
aagcaattaaccaatggttatgatcattattttgtgatggatagaaacccagacaataaa
aacagtttgcagactattgcggtattaaaagatccgctttctggccgagaactcgaaatt
agtaccacagaagtcggcgtgcaattttatagtggcaactttctcgatggcagccatatt
gatgatgaaggttatagcattaatcaattccatggcctgtgtttagaaacccacggttat
ccgaacgcggtaaacattgaccatttcccgagtgtcatgcttgaggcaaatactcaatat
caacaaattacggtacataagtttaagaatatttaa

DBGET integrated database retrieval system