KEGG   Shewanella sp. ANA-3: Shewana3_2213Help
Entry
Shewana3_2213     CDS       T00428                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
shn  Shewanella sp. ANA-3
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:shn00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Shewana3_2213
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Shewana3_2213
Enzymes [BR:shn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Shewana3_2213
Two-component system [BR:shn02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Shewana3_2213
Bacterial motility proteins [BR:shn02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Shewana3_2213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2659747..2660802)
Genome map
AA seq 351 aa AA seqDB search
MTIKVLVVDDSALIRNLLGKMIEADPELSLVGMAADAYMAKDMVNQHRPDVITLDIEMPK
VDGLTFLDRLMKARPTAVVMISSLTEEGADATFNALGLGAVDFIPKPKLDSPQDFNEYQD
LILEKIKSAANAKLKTQRTQPVAATPPSLKPNLANRVINTQLLAIGASTGGTEAILYLLQ
QFPAVMPPIVITQHMPPGFTRTFAERLNKLTRLNVKQADDGERLLPCYVYIAPGDQHLEV
IKVGGSFKTRLTQGDKVSGHRPSVDVLFNSVAACAGANTTAAILTGMGKDGADGMALIDQ
QGGKTFAQGEQSCVVFGMPREAIKRGVIHHVVELPQLADKMLNYLASLKRD
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgacgataaaagtactagtggtagatgattcggcactgatccgtaacctattgggcaaa
atgatcgaggctgatcctgagttatctttggtgggtatggccgccgatgcttatatggcc
aaggatatggtgaatcagcatcgccccgatgtgattacattagatattgaaatgcccaag
gtggatgggctgacctttttagaccgattgatgaaggccagacctacagcggtggtaatg
atttcctcattaaccgaagagggcgccgatgccaccttcaacgcgctaggattaggtgcg
gtggattttatccctaaaccgaaattagactccccccaggattttaatgaatatcaagat
ttgattctggagaaaattaaatcggcggcgaatgctaagctgaaaacccaacgcactcaa
cccgttgctgcgactccgccaagcctaaaacccaaccttgcaaatcgcgtgatcaatact
caactactggcaattggcgcttcgacgggcggcactgaagccattttatatctgttgcaa
cagtttcctgcagtcatgccaccgatagtgatcacccaacatatgccgccgggctttacc
cgcacctttgctgagcggctaaataaacttacccgtttgaatgttaagcaagccgatgat
ggcgaacgtttattgccctgttatgtgtatattgcgcccggagatcagcacttagaagtg
attaaagtcggcggcagttttaagacccgtttgacccaaggtgataaggttagcggccat
aggccctcggtggatgtgttgtttaattcggttgcggcgtgtgcgggggccaataccacg
gcggctatcctcacaggaatgggcaaagatggtgccgatggcatggcattaatcgaccag
caggggggcaaaacctttgctcagggggaacagagctgtgtggtgtttggtatgccaagg
gaagcgattaaacgcggcgttatccatcatgtggtcgaactgccgcaactggcggataaa
atgctcaactatttagcctcgcttaagcgagactaa

DBGET integrated database retrieval system