KEGG   Shewanella sp. ANA-3: Shewana3_2247Help
Entry
Shewana3_2247     CDS       T00428                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
shn  Shewanella sp. ANA-3
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:shn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Shewana3_2247
Enzymes [BR:shn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Shewana3_2247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2707752..2709857
Genome map
AA seq 701 aa AA seqDB search
MNHSTELTPPKESTQWVEAGALRLKAPLAELLKYWEKERLITPLDRHFALEMARLHPNDA
QEPLFMLLCALLSQQLSAQHTCLVLEHIVPANPMAESVNHCQIRLSLPELIARLQNFEAV
GEPHSNKPLIFDGGRLYLERYHHFETEVANALTRLSSSQPANSNDKDSDAPLRRQLDYLF
PNAASSHAATTLEPHIDWQKVATATALGKKLAVITGGPGTGKTTTVTKLLLLQQLGSPKQ
IRLVAPTGKAAARLSESIKASKARLEQELKQAQATNEQVQSHETQALLAALKQVPEEAST
LHRLLGVIPNSAQFRHHQGNPLRLDLLIVDEASMVDLPMMYKLLTALPEQAGLILLGDQD
QLASVEAGAVLADICAGLKYESDQHSEWRMRYSQAQAEQLSKLTSFDLRAYIHREPKIGD
SLCMLTHSHRFKGDAGIGLLASAVNRSDLAGILTVWQRGLAELTWLEHSMALSQTQAKIS
EPANNSGLHALLTQACEQYAEYLRPLQISDPSSVPSAIEAIARFNQYRILCAMRSGDYGV
EGINQTVTKALSQAKLIHPQQEFYLGRPIIIQSNDYNLGLFNGDIGLILQDEDRPERLMA
HFIKADGKLLKVLPARLPSHETCYAMTVHKSQGSEFNRVALVLPPNPSLVQWQLLTKELV
YTAITRAKQHFSCLGTQQVFERASQQATQRASGLADRLWRD
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacagcaccgaactgactcccccaaaagaatcaacccaatgggttgaagctggc
gcactcagactcaaggcgccgctcgcagagctactcaaatactgggaaaaggagcggctg
atcaccccgctcgatcgccattttgcccttgagatggctaggcttcaccccaatgacgcc
caagagccactgtttatgctgctgtgcgccctgttaagccaacagctctcggcccaacat
acctgcctagtgctcgaacatatagtgccagccaatccgatggcagagtcggttaatcac
tgccaaatccgtttgagcctgccagagctgattgcaaggctgcaaaattttgaggccgtt
ggcgaacctcacagcaataaaccactgatttttgatggcggccgactctatcttgagcgt
tatcatcatttcgaaaccgaggtggccaacgccctgacaaggctatcttcgagtcaaccc
gccaacagcaatgataaagattcagacgcgccgctacgcaggcagctcgattacttattt
ccaaacgccgcatcttcccatgcagccacaacccttgagcctcatatcgactggcaaaag
gtggcaacggcaacggcgctcggcaagaagcttgcggtgatcaccggcggccctggtaca
ggcaaaaccaccacagtgactaagttactgttgctacagcaattaggttcaccaaaacag
ataagactcgtcgccccgacaggtaaggccgccgcccgtttaagtgaatcgataaaggcc
tcgaaagcaagactcgagcaggaactcaaacaggctcaagcgacaaacgaacaagtacaa
agtcacgaaacccaagcgctgttagccgcgctcaagcaagtgccggaagaggcatcaacc
ttacatcgtctgctgggggttatccccaattcggcgcagtttcgtcaccatcagggcaat
cccctgcggctagatctcttgattgtcgatgaagcctcaatggtcgatttgccaatgatg
tataagctgctcacggccctccccgaacaggcgggtttgatactgcttggggatcaggac
caactcgcctcggttgaagcaggcgcagtgctagccgatatttgcgcaggactaaaatac
gagtcagaccaacactctgaatggcgaatgcgttatagccaagctcaggccgaacaattg
agcaagctcaccagctttgatctgcgcgcctatattcaccgcgagccaaagattggcgac
agtttgtgtatgttgacccacagccacagatttaagggcgatgcgggcattggcctatta
gccagtgcggtgaatcgctccgatctggcggggattttgaccgtatggcaacggggactg
gccgagcttacttggctagaacacagtatggctctgagccagacccaagccaaaatcagc
gagcctgcaaacaacagcggacttcatgccctgctaacacaggcctgtgagcaatacgct
gagtatttacgtccgctgcaaatttcagatccaagcagtgtgccaagcgccatcgaagcc
attgcccgctttaaccagtatcgcatcctatgcgccatgcgcagtggcgattatggtgtc
gaaggtatcaatcaaactgtgactaaggcgctgtctcaggccaagctgatccatccccag
caagagttttacctcggcagaccgattattatccaaagcaacgactataacttgggcctg
tttaacggtgatattggcttgattttgcaggatgaagacaggccagagcgactgatggcc
cactttatcaaagccgatggcaaactgcttaaagtgctcccggcaaggctacctagccat
gaaacctgctacgccatgacggtacataaaagtcagggcagtgaatttaatcgcgtcgcc
ctcgtacttccgccaaatccgagcctagtacagtggcaattgctcaccaaggagcttgtc
tacaccgcgattacccgtgcaaaacaacactttagctgtttaggaacacagcaagtcttc
gagcgtgcaagccagcaagccacccaacgggcctcaggtttagccgataggctctggcgc
gattaa

DBGET integrated database retrieval system