KEGG   Shewanella sp. ANA-3: Shewana3_2408Help
Entry
Shewana3_2408     CDS       T00428                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
shn  Shewanella sp. ANA-3
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2886847..2887872
Genome map
AA seq 341 aa AA seqDB search
MSRDLLQTAALNLKKAVPLMLKHQIPTTPINYALWYTYVGEQNPALNAQLDTVIAHYNTC
PPVSSELLFRQYVADPVELDVRDMRLNLEAMATELSQSIRDTNLDATEFQTCINTNFAKL
NGIEEGALSVEQVLDLVRNLVKESENIRSSTEYFTSQLQKAQTEIDALKQKLEKSEKDVL
YDALTGCLNRRAFDADLAGMLAQAPEGTCLILVDIDHFKAFNDNYGHQLGDQVLKAVSKR
LQEACRDGCKLYRFGGEEFAIIVPKSQLRIARQLAEAMRRGLEKLSLKDRRKDQRIDNIT
ASFGVAQWQEKQVAIHLIERADMLLYEAKRLGRNRVMPMSN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgagatttattacaaaccgcagccttaaatcttaaaaaagcggttcccttaatg
ctcaagcatcaaattcccaccacgccaatcaattatgccctgtggtatacctacgtgggc
gaacaaaacccagcgttaaacgcacagcttgatacggttatcgcccactacaacacttgc
ccgccagtcagtagcgagttgttgtttcgccagtatgtcgccgatccggttgagttggat
gttcgcgatatgcggctcaaccttgaggccatggccactgagctgtcgcaatcgattcgg
gataccaatctcgatgcaactgagttccagacctgtattaacaccaactttgccaaactc
aatggcattgaagaaggcgcgcttagcgtcgagcaagtgctggatttagtgcgtaatttg
gtgaaagagtccgagaatattcgctcgagcactgagtatttcacttcccagttacaaaaa
gcacagactgagattgatgcgttaaaacaaaagcttgaaaaatcagagaaagatgtactt
tacgatgcactcacgggctgtttaaaccgccgcgccttcgacgccgacctcgccggcatg
ttggcacaggcccccgagggcacctgtcttatcttggtcgatatcgatcactttaaagcc
tttaacgacaactatggccaccagctgggcgatcaagtattaaaagctgtatcaaagcgt
ttgcaggaagcctgtcgggatggttgtaagttgtaccgcttcggcggcgaggagtttgcg
attatcgtgccgaaaagccaactgcgtattgcgcggcaactggccgaggccatgcgccgt
gggctcgagaaactcagcctcaaggataggcgcaaagatcaacgtatcgacaatatcacc
gcctccttcggtgtcgcccagtggcaggaaaaacaagtggctattcacctcatcgaaaga
gcggatatgctactttatgaagccaaacgcttaggtcgaaatcgggtgatgccgatgagc
aactag

DBGET integrated database retrieval system