KEGG   Shewanella sp. ANA-3: Shewana3_2425Help
Entry
Shewana3_2425     CDS       T00428                                 

Definition
di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
shn  Shewanella sp. ANA-3
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2907852..2908853
Genome map
AA seq 333 aa AA seqDB search
MIKLTAIAISIMAMLGGHYAVAAEPIEVITPAKITEPEKVELGKMLFFEPRLSKSGFISC
NSCHNLSTGGVDALPTSIGHHWQEGPINSPTVLNADFMLAQFWDGRASDLKEQAAGPIAN
PKEMGFTHELATETIASMPAYRARFAKVYGDDKVDIDRLTDAIAAFEKTLVTPNSPFDQY
LLGKQDAISSEAKAGYQLFKDKGCVSCHNGPAVGGTMFMKMGLIKPFHTNNPAEGRKGVT
GKEADKYVFKVPTLRNIELTYPYFHDGSVWTLEEAVNTMADIQLGQKLTDKETKEMVSFL
NSLTGEQPQITLPILPPSNKATPRPVPFAAATK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgataaaactcaccgctatcgcgatcagtattatggccatgttaggcgggcactacgcc
gttgctgccgaaccgattgaagtgattacgcctgctaaaatcactgagccagaaaaagtc
gagctgggtaagatgctgtttttcgaacctagactgtcgaaatcaggctttatctcctgt
aattcttgccacaatctttccaccggtggcgtggatgccctacctacatcgattggccac
cattggcaagagggtccaattaactccccaaccgtgctgaacgccgactttatgctggcg
caattctgggatggccgtgccagcgacttaaaagaacaggccgcgggtccgattgccaat
ccgaaggaaatgggctttacccatgagctggccaccgaaaccattgcctcaatgcccgca
taccgtgctcgctttgctaaggtctacggtgatgacaaagtcgatatcgatcgtttaacc
gatgccattgccgccttcgaaaaaaccttagtcacaccgaatagccccttcgatcaatat
ttattgggtaaacaggatgcgattagcagcgaagccaaagcgggttaccaactgtttaag
gacaaaggctgcgtcagttgccacaacggccctgcggtcggtggcactatgtttatgaag
atgggcttaatcaaaccgttccacaccaataatcctgccgaagggcgtaaaggcgtgacg
ggcaaagaagccgataaatatgtgtttaaagtaccgacgctgcgtaatatcgagctcacc
tatccctacttccacgatggcagcgtatggacgctcgaagaagcggtcaataccatggca
gatattcagttagggcaaaagcttaccgacaaggaaaccaaggaaatggtgtcgttttta
aattcactcacaggtgaacagccgcagatcactctgccaattctgccgccatcgaataaa
gcgacgccgcgccctgtaccatttgcagcagcaaccaagtaa

DBGET integrated database retrieval system