KEGG   Shewanella sp. ANA-3: Shewana3_2523Help
Entry
Shewana3_2523     CDS       T00428                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
shn  Shewanella sp. ANA-3
Pathway
shn00010  Glycolysis / Gluconeogenesis
shn00620  Pyruvate metabolism
shn00640  Propanoate metabolism
shn00680  Methane metabolism
shn01100  Metabolic pathways
shn01110  Biosynthesis of secondary metabolites
shn01120  Microbial metabolism in diverse environments
shn01130  Biosynthesis of antibiotics
shn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shewana3_2523
   00620 Pyruvate metabolism
    Shewana3_2523
   00640 Propanoate metabolism
    Shewana3_2523
  Energy metabolism
   00680 Methane metabolism
    Shewana3_2523
Enzymes [BR:shn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Shewana3_2523
Lipid biosynthesis proteins [BR:shn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Shewana3_2523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N PhnJ
Motif
Other DBs
NCBI-ProteinID: ABK48752
JGI: Shewana32523
UniProt: A0KY83
Position
3019358..3021310
Genome map
AA seq 650 aa AA seqDB search
MSSQSLYKVSGNIAANALVNNDQYKKMYQESIVNPEGFWREHGKRIDWIKPYTKIKKTTF
DDHNLSINWFYDGTLNASANCLDRHLAEHSDRVAIIWEGDNASEQRQITYGELHTQVCKF
ANALRSQGVRRGDIVTIYMPMVPEAAVAMLACARIGAVHSVVFGGFSPDSIASRVIDGKS
KVVITADEGMRGGRAIPLKRNIDDALKHPDVTSVEKVIVLKRTGGKVDWVEGRDVWWHSL
VETASEHCAIEEMGAEDPLFLLYTSGSTGNPKGVLHTTGGYMVYASMTHEYVFDYKPGEI
YWCTADVGWITGHSYMVYGPLANGATVLIHEGIPNYPSPARLGEMIDRHKVNILYTAPTL
IRALMAEGKQHFDKYDGSSLRIMGSVGEPINPEAWRWYHEVIGHEHCPIVDTWWQTETGG
ILITPLPGATDTKPGSATRPFFGVQPALVDNMGNILEGATEGNLVLLDSWPGQMRTVYGD
HERFVLTYFKTFRGMYFTGDGARRDEDGYYWITGRVDDVINVSGHRLGTAEVESALVSHE
LVAEAAVVGYPHDIKGQGIYAYVTLTRGTEESEELRQELRQWVRKEIGALATPDLIQWAT
GLPKTRSGKIMRRFLRKIAANEVTNLGDASTLADPAVIETLIETRLNRNE
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgcagtctctctacaaagtctccggcaatatcgctgccaatgcacttgtaaat
aacgatcaatataaaaaaatgtaccaagagtcgattgtcaatccagagggtttctggaga
gagcacggcaaacggatcgattggataaagccatacactaaaatcaaaaaaaccactttt
gacgatcataacttatcgattaactggttctacgacggcaccctaaacgcctcagccaac
tgcttagatcgccatctagcagagcacagcgaccgcgttgccattatttgggaaggcgat
aacgccagcgaacaacgtcaaatcacctacggtgagctgcacactcaagtgtgtaagttt
gccaacgccctacgcagccaaggcgtgcgtcgtggggatattgtgaccatttatatgcca
atggtgccagaagcggcggtggcaatgctggcctgtgcccgcatcggtgccgtgcattcg
gtggtctttggtggcttctcacccgattctatcgcttcaagggttatcgacggtaaatct
aaagtggttatcaccgccgatgaaggtatgcgtggtggccgcgcgatcccactcaaacgc
aacatcgacgatgcgctaaagcatcccgatgtcaccagcgttgagaaggtgattgtactt
aaacgtactggcggcaaggttgactgggtcgaaggccgcgatgtgtggtggcattctctg
gttgaaaccgcatccgagcactgcgccattgaagaaatgggcgccgaagatccgctcttc
ttactttatacctctggttcaactggtaatcccaagggcgtattgcacaccaccggcgga
tatatggtgtatgcctctatgacccacgagtatgtgttcgattacaaacccggtgagatt
tactggtgtaccgccgacgtgggttggatcacgggtcattcctacatggtgtacggccca
ctggcgaacggtgcgaccgtgcttatccacgaagggatccctaattacccaagccctgcg
cgtttaggcgagatgattgaccgtcacaaggtgaatattctctatacggcaccgacactt
atccgtgcactgatggccgaaggtaaacagcattttgacaagtatgatggcagctcgctg
cgcatcatgggctcagtgggtgaacccatcaacccagaagcttggcgctggtaccacgag
gtcatcggtcatgagcattgcccgattgtcgatacttggtggcaaaccgaaaccggcggc
attttgattacgccattaccaggtgcaaccgataccaaacccggctcggcgactcgtccc
ttctttggggtacaaccggcgctcgtggacaacatgggtaacattttagaaggtgcaacc
gaaggtaacttagtgctgctcgactcatggccaggccaaatgcgtaccgtatatggcgac
catgaacgcttcgtgctgacctacttcaaaaccttccgtggcatgtactttaccggtgac
ggcgcgcgccgcgatgaagacggttactactggatcaccggccgtgtggacgatgtgatt
aacgtctccggccacagattaggtacagcagaggtagaaagtgcactggtgtcacacgaa
ctggtcgctgaagccgctgttgtgggctatccccatgatattaaaggccaaggtatttac
gcctatgtgacgttaacccgcggcacagaagagagtgaagagcttcgccaagagctgcgc
caatgggttcgcaaagaaattggcgctctggccacaccggatcttatccagtgggcgaca
ggattacctaagacacgttcaggcaaaatcatgcgccgtttcctgcgtaagatcgccgcg
aacgaagtgaccaacttaggtgatgcatcaacactggccgatccagccgtgattgagacc
ttgattgaaactcgcttgaatcgtaacgagtaa

DBGET integrated database retrieval system