KEGG   Shewanella sp. ANA-3: Shewana3_2553Help
Entry
Shewana3_2553     CDS       T00428                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
shn  Shewanella sp. ANA-3
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shewana3_2553
Enzymes [BR:shn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Shewana3_2553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3055236..3056084
Genome map
AA seq 282 aa AA seqDB search
MGSVTTKKHANGLDYVEVNTALCQARIFLQGAQIDHFQPVGKPPLLWVSSADDYQPGNGI
RGGVPVCWPWFGMSNQANFPQHGFARTRIWTLESVEMRNQLVDLRFSLTISEEDKVFWPH
HTQVNVLFTLGETLSISLVNTNLGDVPVTLTQALHSYFPIEDIHQLKATGFSGAQYIEFA
EGPYPQTTDDVLFDRETDRVYTKLGPVQHLYTPQGVIEVSRENSHSAVLWNPWIEKSTRL
ARFNDDDYLTMVCLEAANVLEDKLTLAPGESHSLVTHIRWAD
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgggttctgttaccaccaaaaaacacgcaaacgggctcgattatgtcgaagtaaacact
gcgttatgccaagcaaggatttttttacagggcgcacaaatcgaccattttcaacccgta
ggtaagccgcccttgttatgggtgtcttcggcggatgactatcaacccggtaatgggatc
cgtggcggtgtacccgtctgctggccttggtttggcatgagcaatcaagctaattttcca
caacatggttttgcccgcacccgtatttggacactcgagtcagttgagatgcggaatcaa
ctggtggatttacgttttagcttaaccatcagcgaagaagacaaggtcttttggccgcac
catacccaagtcaacgtgctctttaccttaggtgaaaccttaagtatcagcttagttaat
actaaccttggcgatgtgcccgttacgctcacccaagcactacacagctattttccgatt
gaagatattcaccagcttaaagccactggttttagtggcgctcaatatattgagtttgcc
gaggggccttatccgcaaacgacagatgatgtgctatttgaccgcgaaaccgaccgcgtt
tacaccaagctaggcccagtacaacacttatatacgccccaaggtgtgattgaagtgagc
cgcgaaaatagccactcggccgtgctgtggaacccttggattgaaaaatcgactcgcctt
gcccgctttaatgacgatgactatctgaccatggtgtgtctggaagccgccaatgtgctt
gaagataaattaacgctggctcccggcgagagtcacagtttagttacccatattcgctgg
gcagactaa

DBGET integrated database retrieval system