KEGG   Shewanella sp. ANA-3: Shewana3_2782Help
Entry
Shewana3_2782     CDS       T00428                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
shn  Shewanella sp. ANA-3
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:shn00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:shn00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:shn00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:shn00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3321505..3322413
Genome map
AA seq 302 aa AA seqDB search
MKQHQIRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSEAIDAGIKEIVLVTH
ASKNSIENHFDTSFELEAQLERRVKRQLLEAVQSICPKDVTVISVRQSQAKGLGHAILCA
KSVVGDAPFAVLLPDVIIDDASCNLKTDNLAAMVSLFDETQVGQIMVEGVPHHLVNQYGI
ADVNGHDLQPGESEPLVELVEKPPVDEAPSNLAVVGRYVLPAAIWPLLAKTPAGAGDEIQ
LTDAIAMLMKQETVNAYYMQGKSHDCGNKQGYMRANVEYALRHSEIGEDFAQYLKTVVKG
IK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacatcaaattcgtaaagccgttattcccgtcgctggacttggcactcgtatg
cttcctgcgaccaaggcaattcctaaggaaatgctacccgttgttgataaacccttgatc
caatatgtggttagtgaagccattgatgcgggtatcaaagaaattgtcctcgtgacccac
gcaagtaaaaactctatcgaaaaccatttcgacaccagttttgaattagaagcgcaatta
gagcgccgcgtgaagcgtcaattactcgaagcggtacaatccatttgcccaaaagacgtg
acagtgatcagcgtgcgtcaatcccaagctaaaggcttaggccatgcgattttatgtgcc
aaatccgttgtaggtgatgcgccgtttgccgtgttgttgccggatgtgattatcgatgat
gccagctgcaacctgaaaaccgacaacttggccgccatggtgagcctgtttgatgaaacc
caagtgggccaaatcatggttgaaggcgtaccacatcatttagtgaaccaatatggtatt
gcggatgtgaatggccacgatctacaacctggtgagtcagagccattggtcgaactcgtt
gaaaagccaccggttgacgaagcaccgtctaacttagccgtggtgggtcgttacgtgttg
cccgctgcgatttggccactgctggctaaaacccctgcaggcgcgggtgatgaaatccag
ttaaccgacgccattgcgatgttgatgaaacaagaaaccgtaaacgcttactacatgcaa
ggtaagagtcatgactgcggtaacaagcaaggctatatgcgcgctaacgtggaatacgcc
ctgcgccacagcgaaatcggtgaagattttgcgcaatatttaaaaacagtcgtaaaagga
attaaataa

DBGET integrated database retrieval system