KEGG   Shewanella sp. ANA-3: Shewana3_2825Help
Entry
Shewana3_2825     CDS       T00428                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
shn  Shewanella sp. ANA-3
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:shn00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:shn00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3374146..3374481)
Genome map
AA seq 111 aa AA seqDB search
MDLISMLYSQTQTKLAQIAHELQSAGLWSTRAPSDEAMASTAPFACDLMSLAQWLQFIFI
PRMQALIDAGQPLPSKIAIAPMAEHVWSEQAALTPLIGVLNELDMLLNEPR
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaccttatatcgatgctttacagccaaactcaaaccaaactagcccaaattgcccac
gagctacaaagtgcagggctttggtctactcgtgcgcccagtgatgaagctatggccagt
acggcgccttttgcctgcgatctgatgtcgttagcgcaatggttgcagtttatctttatt
ccgcgcatgcaagcccttatcgatgcggggcaacctttgccaagtaaaattgcgatagcc
ccgatggcggaacatgtgtggtccgaacaagcggcgttaacacctttaatcggtgtctta
aatgaattggatatgttgttaaatgaacctagatga

DBGET integrated database retrieval system