KEGG   Shewanella sp. ANA-3: Shewana3_2875Help
Entry
Shewana3_2875     CDS       T00428                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
shn  Shewanella sp. ANA-3
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Shewana3_2875
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Shewana3_2875
Enzymes [BR:shn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Shewana3_2875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3437655..3438140
Genome map
AA seq 161 aa AA seqDB search
MTSTIYSHSANDIQGNPTALAQYQGKVILIVNTASECGFTPQYKGLEALYQKYKSQGLVV
LGFPCNQFGAQEKADEKGIQSFCELNFGVSFPLFSKIEVNGEHTHPLYQYLKKAAPGVLG
TERIKWNFTKFLINRQGEVVARFAPTTKPEAISDKIEALLK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgactatctatagccatagcgcaaacgacattcaaggcaatccaacggcactg
gcacaatatcaaggcaaagtgatcttaattgtgaataccgccagtgagtgcggttttaca
ccacagtacaagggcttagaagcgctctatcaaaaatataaatcacagggattggtggtt
ttaggcttcccatgcaatcagtttggtgcccaagaaaaagctgatgagaaaggcatccaa
agtttttgtgaactcaactttggcgtgagttttccgctgttttcgaaaatagaggtaaac
ggtgagcacactcaccctttatatcagtacctaaaaaaagccgcgccgggcgtattaggc
acagaacgcattaagtggaatttcactaaattcttaattaatcgtcagggcgaagtggtc
gctcgctttgcgccaaccacaaaaccagaggccattagtgacaagatagaagcgctttta
aaataa

DBGET integrated database retrieval system