KEGG   Shewanella sp. ANA-3: Shewana3_2875Help
Entry
Shewana3_2875     CDS       T00428                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
shn  Shewanella sp. ANA-3
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:shn00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:shn00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3437655..3438140
Genome map
AA seq 161 aa AA seqDB search
MTSTIYSHSANDIQGNPTALAQYQGKVILIVNTASECGFTPQYKGLEALYQKYKSQGLVV
LGFPCNQFGAQEKADEKGIQSFCELNFGVSFPLFSKIEVNGEHTHPLYQYLKKAAPGVLG
TERIKWNFTKFLINRQGEVVARFAPTTKPEAISDKIEALLK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgactatctatagccatagcgcaaacgacattcaaggcaatccaacggcactg
gcacaatatcaaggcaaagtgatcttaattgtgaataccgccagtgagtgcggttttaca
ccacagtacaagggcttagaagcgctctatcaaaaatataaatcacagggattggtggtt
ttaggcttcccatgcaatcagtttggtgcccaagaaaaagctgatgagaaaggcatccaa
agtttttgtgaactcaactttggcgtgagttttccgctgttttcgaaaatagaggtaaac
ggtgagcacactcaccctttatatcagtacctaaaaaaagccgcgccgggcgtattaggc
acagaacgcattaagtggaatttcactaaattcttaattaatcgtcagggcgaagtggtc
gctcgctttgcgccaaccacaaaaccagaggccattagtgacaagatagaagcgctttta
aaataa

DBGET integrated database retrieval system