KEGG   Shewanella sp. ANA-3: Shewana3_2935Help
Entry
Shewana3_2935     CDS       T00428                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
shn  Shewanella sp. ANA-3
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Shewana3_2935
Enzymes [BR:shn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Shewana3_2935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3523935..3526340)
Genome map
AA seq 801 aa AA seqDB search
MGLEKLLYLRGVGADFTDCFGQYIRIPEADRQGILTCMLQEKNTQACEAKDEPLTSLPSG
DELDAQVYELDAHHWTQVLPAFHWCYVDEPWVCLYLPQSYRGDLLLTFTCEQGERVILEV
PFSALKPIGDYRIQAQELAQFGNSPFANECQYLQYRLDLLGHEFHCRDAGDAAEQDSKAE
MRRSWENVSAAPNTSNNKDNLSDLSCLGLGYHALSVSLLGLADAQQGLASASTSAASNSS
ASNSAASKTTEFHGTFMVAPRTAYQGVMSAVAQGKRHKPWGVSLQLYSLRSESQWGMGDF
GDLEQLIGLVAEYGADFIQLNPLHALDIAAPEHPSPYSPCDRRRLNPLYIHLPSVPEFEP
LKTEFTAKEWQETIALLNAENWLDYPKVSELKYRAFARLYTVFCEHHLQPNTPRAQRFED
FVAEQGAPLREFAQAESLRSPRAIAQDEGFYLYLQFVAEDQLQLCQLKAKEAGMGIGLIR
DLAVGAALQGVEVQANSQQFCLNASIGAPPDPFAPQGQNWGLTPLDPVKLKQHQYRHFIE
LTRANMTHCGALRIDHVMGLLRLWWWPLDKRLGHGAYVYYPVETLLAILCLESQRARCVV
IGEDLGLVPPDIIHRLYQAGVYSNELFYFCKDHQGFKPPSHYKFQSLMMLANHDVPTLVA
WWTGSDLHLRRQLELFNTDEQLGEALAGREQEKHQLAQCLISQGLLPETDIQQVDIEDLL
TAWMPFGASGNSALYSVQWCDLLGDRHAVNIPGTWLEYPNWQRRLPISLSEAAARPALAE
RLQRIAAARHLPETAAHTDTL
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atggggctggagaagttgctgtatttgcggggcgtaggagcagactttaccgactgcttc
ggccagtacatccgcattcccgaggcggacaggcaagggattttgacctgtatgttgcag
gagaaaaatactcaggcctgcgaggcaaaggatgaaccattaacgagtttacccagtggc
gatgagcttgacgctcaggtatatgaactcgatgcacatcattggacacaagtgttgccg
gcgtttcattggtgctatgtcgacgaaccttgggtctgtctgtatttacctcaatcttac
cgtggcgatctgctgctcacctttacctgtgagcaaggggagagggttatcctcgaggtg
ccgttttcggcgctaaaacccattggggattatcgtattcaggcgcaggaattggcacag
tttggcaatagcccctttgccaatgagtgtcagtacctgcaataccgtctcgacctttta
ggtcatgagtttcattgccgtgatgcgggcgatgccgctgagcaagatagcaaggctgag
atgcgccgttcatgggaaaatgtcagcgccgcaccaaacacatctaacaataaagacaac
ttaagtgatttatcttgcttgggattggggtaccacgcactgagcgtcagtttgcttggg
ctggcagatgctcagcaaggccttgcatcggcaagcacctcagcagcaagcaactcatca
gcaagcaactctgccgcaagtaagacgactgaattccatggcacttttatggtggcaccg
agaaccgcctatcaaggggtgatgagcgctgtagctcaaggaaagcgccataaaccgtgg
ggtgtgagccttcagctctatagtctgcgcagcgaaagccaatggggcatgggcgacttt
ggcgatttagagcagcttatcggtttagtggccgaatatggcgccgattttattcagctt
aatccattgcatgccttagatattgccgcgccggaacatccgagtccctatagtccctgc
gatcgtagaaggctgaatccgctgtatattcatttacctagcgtgcctgaatttgagcca
ttaaagacggagtttacggcgaaagagtggcaagaaaccattgccctactcaacgcggag
aactggctcgattaccccaaggtcagcgagcttaagtaccgcgcctttgcacgtttatat
actgtcttttgcgaacaccatttacagcccaacacacccagggcgcagcgatttgaggat
tttgtggcagagcagggcgcgccgctcagggaatttgcccaagccgaatcgctacgcagc
ccaagggcgatcgcacaggatgaaggtttttatttatatctgcagtttgtggccgaagat
caactgcaattgtgccagctcaaagccaaagaagcgggaatgggcattgggcttattcgt
gatttggccgtaggcgctgcgttgcaaggcgttgaggttcaagccaattcacagcagttc
tgcttaaacgccagcataggcgcgccgccggatcccttcgcgccgcagggacaaaactgg
ggacttacgcccctcgatcccgtcaagctaaaacagcatcaatatcgccattttattgaa
ctgactcgcgccaatatgacccactgcggggcactgcgaatcgaccatgtgatggggctg
ctgcgactctggtggtggccactggataagcgcctcggccatggcgcctatgtgtattac
ccggtcgaaaccctgttggcgattctctgccttgagagtcaacgtgcccgctgtgtggtg
attggtgaagatttgggcctagtgccgcccgatattattcatcgcctgtatcaggcgggg
gtttactccaacgagttgttctacttctgcaaagaccatcaaggctttaagccgccgagc
cactataagttccagagtttgatgatgctggcaaaccacgatgtgccgacgttagtcgcc
tggtggacgggcagcgatttgcacctgaggcgacaactcgaactgttcaataccgacgag
caattaggtgaggccttagccggacgtgagcaggaaaaacaccagctggcgcagtgctta
atctcccagggcttattgccggagacagatattcaacaggttgatattgaagatttatta
acggcgtggatgccatttggcgcctcgggcaacagcgcactttacagtgtgcagtggtgc
gatctgctcggggatcgccatgcggtgaatattcccggcacttggctcgagtaccccaat
tggcagcggcgattgcccatcagcctaagcgaagctgcagctaggcctgcgctggctgag
cgtttgcaacgcattgctgcggcaagacatttgccagaaacggctgcgcatacagatacc
ctttga

DBGET integrated database retrieval system