KEGG   Shewanella sp. ANA-3: Shewana3_2942Help
Entry
Shewana3_2942     CDS       T00428                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
shn  Shewanella sp. ANA-3
Pathway
shn00630  Glyoxylate and dicarboxylate metabolism
shn01100  Metabolic pathways
shn01110  Biosynthesis of secondary metabolites
shn01120  Microbial metabolism in diverse environments
shn01200  Carbon metabolism
Module
shn_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Shewana3_2942
Enzymes [BR:shn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Shewana3_2942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABK49168
JGI: Shewana32942
UniProt: A0KZE9
Position
complement(3531910..3533232)
Genome map
AA seq 440 aa AA seqDB search
MTKATQTSRQAQIDAIKKDWAENPRWKNVRRPYTAEEVVALRGSIVPENTIAKRGAAKLW
DLVNGGAKKGYVNSLGALTGGQAVQQAKAGIEAIYLSGWQVAADANLAGTMYPDQSLYPA
NSVPAVVARINNSFRRADQIQWSNGVNPEEENFVDYFLPIIADAEAGFGGVLNAFELMKS
MIDAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGVETLVIARTD
ANAADLLTSDCDPYDRDFVTGERTSEGFYRVKAGLDQAISRGLAYAPYADLIWCETAKPD
LEEARRFAEAIHAQYPDQLLAYNCSPSFNWKKNLDDATIARFQQELSDMGYKYQFITLAG
IHNMWYNMFDLAYDYARGEGMKHYVEKVQEVEFAAAKKGYTFVAHQQEVGTGYFDQVTTV
IQGGQSSVTALTGSTEEEQF
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgactaaggcaacacagacttcacgtcaggcacagattgacgcgatcaaaaaagattgg
gctgaaaatccacgttggaaaaacgtgcgtcgcccatacactgcagaggaagttgtggca
cttcgtggttctatcgtacccgaaaacactattgccaaacgcggtgccgctaaactgtgg
gatttagtcaacggtggcgcaaaaaaaggttatgtgaactcgctaggtgcactgactggc
ggtcaagcggtacaacaggcgaaagccggtatcgaagcaatttacttgtctggttggcaa
gtggcggccgacgctaacttagcgggcactatgtacccagaccaatctttatacccagca
aactcagtacctgcagtggttgcacgtattaacaactctttccgccgtgctgaccaaatt
cagtggagcaatggtgttaatccggaagaagaaaactttgtcgattacttcctgccgatt
attgccgatgcggaagcgggttttggtggcgtactgaatgcgttcgagttaatgaagtcg
atgatcgacgcaggcgccgccggtgtgcactttgaagaccaattggcctctgtgaaaaag
tgcggccatatgggcggtaaagtattagtaccgacccaagaagcggtacaaaagttagtt
gcggcgcgccttgcagccgacgtgagcggtgttgaaactttagttatcgctcgtaccgat
gcgaatgcggcggatttattgacctctgattgcgacccatacgatcgtgacttcgtgact
ggcgagcgcaccagtgaaggtttctaccgcgtgaaagcgggtctggaccaagcgatttct
cgcggtctcgcctacgcaccttatgcggatttaatttggtgtgaaaccgctaagcctgac
ttagaagaagcacgccgctttgctgaggcaatccatgctcagtacccagaccaattgctg
gcctacaactgttcaccttcgttcaactggaagaaaaacttggacgacgcgacgattgcg
cgcttccaacaagagctgtcggacatgggctacaagtaccagttcatcactttagcgggt
atccataacatgtggtacaacatgtttgacctggcttacgactacgctcgtggtgaaggt
atgaagcattatgttgagaaagttcaagaagttgagtttgcagcagcgaagaaaggctac
accttcgtcgcgcatcaacaggaagtgggtactggttacttcgaccaagtcaccacagtg
atccaaggcggtcagtcttctgtgactgcactgactggttcgaccgaagaagagcagttt
taa

DBGET integrated database retrieval system