KEGG   Shewanella sp. ANA-3: Shewana3_3058Help
Entry
Shewana3_3058     CDS       T00428                                 

Definition
tyrosyl-tRNA synthetase (EC:6.1.1.1)
Orthology
K01866  
tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
shn  Shewanella sp. ANA-3
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:shn00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3664316..3665512)
Genome map
AA seq 398 aa AA seqDB search
MADLDQVLAEIRRGTDEILLESDLLEKLKEGRPLRIKLGADPTAPDIHLGHTVILNKLRL
FQELGHEVIFLIGDFTGMVGDPSGKNSTRPPLTREQVLANAETYKEQVYKILDPAKTRIE
FNSSWLEPLGAAGMIRLASQQTVARMMERDDFKKRYASGQSIAIHEFMYPLLQGYDSVAL
KADVELGGTDQKFNLLMGRELQKAEGQKPQAVIMMPLLEGLDGVKKMSKSAHNYIGVSEP
TNEMFGKIMSISDELMWRYFELLSFRPLAEIEQFKQDIANGANPRDTKIALAKEIIARFH
DQAAAESAHQAFIDRFQKGAIPDDIPEVELAAGEGLAIANLLKDADLVGSTSDAMRMIKQ
GAVKMDGEKVDDSRMTLSAGTVAVFQVGKRKFAKVTLV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctgatttagaccaagtattagcagaaattagacgtggtaccgatgagatcctactc
gaatcggatctgctggaaaaactcaaagaaggacgtccacttcgtatcaagttaggcgct
gatcctaccgcaccggatatccatcttggacacacagtaattttaaataaattaagatta
ttccaagagttaggtcatgaagtcattttcttaattggtgactttaccggtatggtgggt
gatccaagtggtaaaaacagtacacgtccacctctcacccgtgagcaagtattagccaac
gccgagacctataaagagcaggtctataaaattttggatcctgccaaaacccgtatcgag
ttcaactcgagctggttagagccattaggcgcagcagggatgatccgtttagcctcgcag
caaaccgttgcccgtatgatggaacgtgacgactttaagaagcgttatgcttcgggtcag
tcgatcgctatccacgaatttatgtatccactgctacagggttatgactcagtagctctg
aaggccgacgttgaattaggcggaaccgatcagaagttcaacctgttgatgggccgtgag
ttacaaaaagccgaaggccaaaagccacaagccgtgattatgatgccactgcttgaaggt
ttagacggcgtgaagaaaatgtctaaatcggcgcacaactacattggtgtgagtgagccc
accaatgaaatgtttggcaagatcatgtcaatttctgacgaattaatgtggcgctacttt
gagttgctgtcattccgtcctttggccgagattgaacagttcaaacaagatatcgccaac
ggtgctaacccccgtgataccaagattgcccttgcgaaggaaatcatcgcgcgcttccac
gaccaagcggcggccgagagtgcccatcaagcctttatcgaccgtttccaaaagggtgct
atcccagatgatatccctgaggttgaattagcggcgggtgaaggcttagcgattgctaac
ttacttaaagatgccgacttagtgggttcgacttccgatgcgatgcgtatgatcaagcaa
ggcgcggtgaagatggacggtgagaaggttgatgatagccgtatgaccttaagcgctggt
acggttgccgtattccaagtcggtaagcgtaagttcgcgaaagtgactctggtttaa

DBGET integrated database retrieval system