KEGG   Shewanella sp. ANA-3: Shewana3_3070Help
Entry
Shewana3_3070     CDS       T00428                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
shn  Shewanella sp. ANA-3
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:shn00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:shn00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3682211..3683230
Genome map
AA seq 339 aa AA seqDB search
MNQFEGSHILSVNQLDLDSIQTIFNVAHRMMPYALREKRTKVLEGAILGNLFFEPSTRTR
VSFGCAFNLLGGHVRETTGMASSSLSKGESLYDTARVLSTYSDVIAMRHPDSYSVKEFAE
GSRVPVINGGDGSNEHPTQALLDLFTIQKELGHAGRGIDGMHIAMVGDLKFGRTVHSLSR
LLCMYKNISFTLISPTELAMPDYVISDIENAGHSIKITDQLEGHLDKADILYLTRIQEER
FPSQEEANKYRGKFRLNRSIYTQHCKSNTVIMHPLPRDSRAQANELDNDLNSHPNLAIFR
QADNGLLIRMALFALTLGVDSQLEKYECPVNWYSRKADR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagttcgaaggatctcatatcctctccgtaaaccagttagatcttgattcaatc
caaactatttttaatgttgcccatcgtatgatgccctatgcacttcgtgagaagcgcact
aaggtgctcgaaggcgccattttaggtaacctgtttttcgagcctagtacccgtacccgc
gtgagttttggctgtgcctttaacttactcggcggccatgtgcgtgagaccacaggcatg
gcctcttcgtccttatctaagggtgagtcactgtacgataccgcacgtgtactctcgacc
tattccgatgtaattgcgatgcgccaccccgactcttattcggtgaaagagtttgctgaa
ggtagccgcgtgccagtaatcaacggtggtgatggttcgaacgagcacccgacccaagcc
ctgctcgatttgttcaccattcaaaaagagttaggccatgctggccgcggtatcgatggc
atgcatatcgctatggtcggcgacttaaaatttggtcgtaccgtgcattccctgtcgcgc
ttgctgtgcatgtacaagaacatcagcttcacactgatttcgccaactgaattagcaatg
cctgactatgtgatctccgacattgaaaatgctggccatagcatcaaaataacagaccag
cttgaaggccacttagataaagccgacatactttatctgacccgcattcaagaagagcgc
ttcccatcccaggaagaagcgaacaaataccgcggtaaattccgtttgaatcgcagtatt
tatacccaacattgcaaatctaacactgtgatcatgcacccgctgccacgggattcgcgt
gcgcaagctaatgagttagataatgatttgaacagccatcctaatctcgctatcttcaga
caggcggacaatggactgctaattcgtatggcactgtttgcattgacactcggggttgac
tcgcaactcgaaaaatatgagtgtcccgttaattggtattcacgtaaagccgatcgctaa

DBGET integrated database retrieval system