KEGG   Shewanella sp. ANA-3: Shewana3_3330Help
Entry
Shewana3_3330     CDS       T00428                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
shn  Shewanella sp. ANA-3
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3991700..3992425)
Genome map
AA seq 241 aa AA seqDB search
MKLTRALSLVIALVVAPLASAATATTPDTAAIKQKLSEMLDVEVISMQDSPIEGLYQAMT
NRGVLYISRDGTKLFHGNLYDLDKGMKNLTEAALAGPRLEMMKPLEDHMLVYKAKDEKHV
VTVFTDVSCGYCRKLHSQMADYNKMGITVRYLAFPRAGVPSANADEMQAIWCAKDPLKAM
TEAKAGQKVSAATCDAKIAEQYELGTSFGVNGTPAIVLEDGSMIPGYQPPADLLRTLEAR
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgacccgagcattatctttagttatcgcgcttgttgttgcgcctctggccagc
gccgctacggcgaccactcccgacaccgctgctattaagcaaaaactcagcgagatgtta
gacgttgaagtgatttcaatgcaggactcgccgattgaaggtttataccaagccatgacc
aatcgtggtgtgctctatattagccgtgatggcacaaaactgttccacggtaacttgtac
gatctcgataaggggatgaaaaacctgacggaagccgcacttgctggcccgcgtctagag
atgatgaagccacttgaagatcatatgttggtatacaaggctaaggatgaaaaacacgta
gtgacggtatttaccgatgtaagctgtggctattgccgcaagttgcatagccaaatggcc
gactacaacaagatgggcattaccgtgcgttacttagctttcccacgtgctggcgtacca
tctgccaatgccgatgaaatgcaagccatctggtgtgctaaggatccattaaaggccatg
acagaagccaaggcgggccaaaaagtgtctgccgcgacctgtgatgccaaaattgccgag
cagtatgagttaggcaccagctttggtgttaacggcacgcctgcaatcgtattggaagat
ggcagcatgatccctggatatcaaccacctgcggatttactgcgtaccttagaagcgcgt
aaataa

DBGET integrated database retrieval system