KEGG   Shewanella sp. ANA-3: Shewana3_3407Help
Entry
Shewana3_3407     CDS       T00428                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
shn  Shewanella sp. ANA-3
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:shn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4076228..4076716
Genome map
AA seq 162 aa AA seqDB search
MTQVFVALGANLEDPKAQLDNAVAALSALAEHQSLKVSPYYGSTPMGDVVQPDYINAVAS
FETSLAPIALLDALQEIENTQGRVRKERWGPRTLDLDLLLYGDAIIDEPRLKVPHYGMKE
RSFVLVPLAAIAPDLVLPCKTPLRSLISEKFLAELQLLGNDH
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggtttttgtcgccctcggggctaatcttgaagatcctaaagctcagctggac
aatgccgttgcggccttgtccgccttggctgaacatcagagtcttaaggtatcgccctat
tacggttccacccccatgggggacgtagtgcaacccgactatatcaatgccgttgccagc
tttgagacctctctggcacccatcgccctgttagatgcactgcaagagattgaaaacact
cagggccgtgttcgtaaagaacgttggggccccagaaccttagatctcgacttactctta
tatggcgatgccattatcgatgagcccagactcaaagtgccacactacggcatgaaggag
cgtagttttgtgctagtgcccttggcggccatagcaccggatctggtgttaccttgtaaa
acgccgctacgcagccttatcagtgaaaaattcttggccgagttacaactactgggcaat
gatcattga

DBGET integrated database retrieval system