KEGG   Shewanella sp. ANA-3: Shewana3_3466Help
Entry
Shewana3_3466     CDS       T00428                                 

Definition
short-chain dehydrogenase/reductase SDR
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
shn  Shewanella sp. ANA-3
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Shewana3_3466
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Shewana3_3466
Enzymes [BR:shn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Shewana3_3466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4156829..4157707)
Genome map
AA seq 292 aa AA seqDB search
MCAPLCCVQGMGKDCDWILKHRETSNMAVEHSSLKGKVGLITGSTSGIGLATAHVLAEQG
CHLILHGLMPEAEGRRLAAEFAEQYHIHTYFSNADLRDPESIHAFMDAGVKALGSIDILV
NNAGIQHTENVAHFPIDKWNDIIAINLSSAFHTIQQAVPAMAEKRWGRIINIASVHGLVA
SVNKAAYCAAKHGIVGLTKVVAIECAEQGITVNAICPGWVDTPLINKQIEAIASNKGLSY
DEAKYQLVTAKQPLPEMLDPRQIGEFVLFLCSSAARGITGASLAMDGAWTAQ
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgccccgctatgctgtgttcaaggcatgggtaaagactgtgactggattttaaag
catcgggagacaagcaatatggcggttgaacactcaagcttaaagggcaaggtagggcta
atcaccggctccaccagtggaattggtttagcaacggcgcatgtgctggcggagcaaggt
tgtcatctgatcctgcacgggttaatgccagaggccgaggggcggcgcctcgctgcggag
tttgccgagcaatatcatattcacacttatttcagtaacgccgatctgcgggatccagag
agcatccatgcctttatggacgcaggcgttaaggcgttgggcagtattgatattttggtg
aataatgccggtattcaacacactgaaaatgttgctcatttcccgattgataaatggaac
gacattatcgccattaacctgtcctcggcctttcataccattcaacaagccgtgcctgcg
atggccgaaaagcgttggggccgcattatcaatatcgcctcggtgcatggtttagtggcc
tcggtcaacaaggcggcctattgtgcggctaaacacgggattgtcggcttaaccaaagtc
gtggctattgagtgcgccgagcaggggattaccgtcaatgcgatttgcccaggctgggtg
gatacgccgctgatcaacaaacagattgaggctatcgccagcaataagggtttaagttac
gacgaggctaagtaccagctcgtcacggcaaaacaacccctgccagagatgctagaccca
cgtcagattggcgagtttgtgctgtttttatgtagcagtgcggcgcggggaattacgggc
gcatcgctggcaatggacggcgcttggaccgcgcaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system