KEGG   Shewanella sp. ANA-3: Shewana3_3477Help
Entry
Shewana3_3477     CDS       T00428                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
shn  Shewanella sp. ANA-3
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Shewana3_3477
Enzymes [BR:shn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Shewana3_3477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4171135..4172046
Genome map
AA seq 303 aa AA seqDB search
MSHILVIGSANADHVMNFEYLPVPGQTLMSRAYRLEHGGKGANQAVACARLCQGDAEVAF
ICHLGQDSVGNDMRTSWLKDGIKAEGITQVANMSTGTALIFVGDNGENSIGIAAGANADL
TPSELEKHYALFANAQFLLIQLETPMETVHHALQTAKRLGITTVLNPAPATSQELDYLKW
VDIITPNETEAEALTGIEVNNEEDAELAAQWLHQQGVATVVITLGSKGAFISSAGFTGLI
PALTVQAIDTVAAGDTFNGALVVGLSEGMSIAAAVGFANAASAITVTREGAQRAIPYRHE
VQR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagccacatactcgttataggcagtgccaacgccgatcatgttatgaattttgagtat
ttgcccgttcccggccaaaccttaatgagccgagcctatcgcttggaacacggtggcaaa
ggagccaatcaggcggtagcctgtgcccgtttatgccaaggggatgcggaagtggcattt
atctgccatctcggccaagacagtgtcggcaatgacatgcgtacaagctggctcaaggat
ggcattaaggccgaaggtattacccaagtcgccaatatgagtacgggcacggcgctgatt
tttgtcggcgataatggggagaactccatcgggatcgccgcgggcgccaatgccgatctc
accccaagcgagttagagaagcattacgccctgtttgccaatgcccaattcttactgatc
cagctcgaaacgccgatggagacggttcaccacgcattgcaaaccgccaagcgcctcggt
attaccacagtgctgaatcctgcgcctgcaaccagtcaggagttggattacctcaaatgg
gtcgacatcattactcccaatgagaccgaggccgaagcacttacaggcattgaggtcaat
aacgaagaagatgccgagcttgccgcccaatggctacatcagcagggcgttgcaactgtc
gtcataaccttaggcagtaaaggcgcgtttatcagcagtgccggttttaccgggttaatt
ccggcgctgacagtgcaagccatagatacggttgccgcgggcgatacctttaatggcgcc
ttagtggtgggtttaagtgaagggatgtcaattgcagcggccgtcgggtttgccaatgcc
gcctctgccattaccgttacccgagaaggcgcccagcgcgcgattccctatcgccacgaa
gtccaacgttaa

DBGET integrated database retrieval system