KEGG   Shewanella sp. ANA-3: Shewana3_3539Help
Entry
Shewana3_3539     CDS       T00428                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
shn  Shewanella sp. ANA-3
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Shewana3_3539
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Shewana3_3539
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Shewana3_3539
Enzymes [BR:shn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Shewana3_3539
Exosome [BR:shn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Shewana3_3539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4238106..4239746)
Genome map
AA seq 546 aa AA seqDB search
MNKKLLVLAISAMLGLAACGSDGDNGAAGTPGSNGSNGSNGSDGKDWTAVNQWYVDAQAR
VTKADGLSVNNEVGAAKNVILFVGDGMGVSTITAARILEGQLKGKTGEENSLSFETLPYV
GLSKTYNVDGQTPDSAGTMSAMMTGVKTDVGVISQAEGVVRANCASTKDQNLVTSLELAA
MAGMSTGVVTTARLTHATPAATYAHVPERDWEADSNLPAEAVTNGCKDIAAQMLDFNYGN
GLNVMMGGGRRSFIPKTLIDPEGKAGKRNDGRDLTAEWLAKYTNAAYVQDRDGFLNVDVK
STDHLLGLFNSSHMEYDYDRTEAGVTGEPSLAEMTAKSIDILKKNIKGYVLIVEAGRIDH
AHHAGNAARALYDTVALSEAVRVAMEKTSANDTLLMVTADHSHVFTIAGYPTRGNPILGL
VKSNDANGIAEVTNSTDANGLPYTTVGYANGMGYASLATGGDERYNFPVDAGRKDLNFVD
TQSAGFHQEALVPLSDETHAGEDVAIFARGPSSDLVQGTVEQNHIFHVMNRAADLVAKAE
AAMAAK
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaaattactggtactcgcaatctctgccatgctgggtttagccgcatgcggt
agcgatggtgacaacggcgcggcaggtacgccgggttcgaatggttctaacggttccaat
ggcagcgacggtaaagactggaccgcagtcaaccaatggtatgtcgatgcacaggctcgt
gtgactaaggccgatggcctgagcgttaacaacgaagtgggcgcggcgaaaaacgtgatc
ctgtttgtcggcgacggcatgggggtttcgactatcactgcggcgcgtattttagaaggt
caattaaagggcaagacgggtgaagaaaactctttatccttcgaaactctgccttacgtc
ggtttatctaagacctataacgtcgatggtcaaacaccagattctgcgggcactatgtcg
gcgatgatgactggggtgaaaaccgatgtgggcgtgatttcacaggcagaaggcgtagtg
cgtgctaactgcgcatcgactaaagaccaaaacttagtgacatcactggaactggccgcc
atggcgggtatgtcgactggtgtggtgactacggcgcgtttaacccacgcaacgcctgcg
gcaacctatgcccacgtgccagagcgtgactgggaagctgactcaaacctgcctgccgaa
gccgtgaccaatggttgtaaagatatcgccgcgcagatgctcgactttaactatggcaat
ggtttaaacgtgatgatgggcggtggtcgccgcagctttatccccaaaacgttgattgat
ccagaaggtaaagcgggcaagcgtaacgatggtcgcgatctgactgccgaatggttagct
aagtacactaatgcggcttacgttcaagatagagacggcttcctcaatgtggatgtgaag
agcactgaccatttactgggtctgttcaactcatcccatatggaatacgactacgaccgc
accgaagcgggcgtaacgggtgagccatcgctcgcagaaatgaccgccaagtcgattgat
attctgaagaaaaacatcaaaggttatgtgctgatcgtcgaagcgggtcgtatcgaccat
gcgcaccacgcgggtaacgccgctcgtgccctgtacgacacagttgcgctatctgaagct
gtccgtgttgcgatggaaaaaacctcggcaaacgacactctgttaatggtgacggctgac
cacagccatgtgttcaccatcgcaggttatccaacccgtggtaaccctatcctaggtctg
gtgaagagtaacgatgcgaacggtattgccgaggtgactaactcaaccgatgctaacggt
ttaccttacacgacagtaggttatgccaacggtatgggttatgcgtcattagcgaccggt
ggcgatgagcgttataacttccctgtggatgcaggccgtaaggacttgaactttgtggat
acacaaagtgctggattccatcaagaagcgttagtgccattaagcgatgaaacccatgcg
ggtgaagacgtggcgatttttgctcgcggcccaagctcggatctggtccaaggtacggtt
gaacaaaaccatatcttccacgtgatgaaccgtgcggcagacttagtcgcgaaagcggaa
gctgcaatggcggcgaagtaa

DBGET integrated database retrieval system