KEGG   Shewanella sp. ANA-3: Shewana3_3579Help
Entry
Shewana3_3579     CDS       T00428                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
shn  Shewanella sp. ANA-3
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shewana3_3579
   00052 Galactose metabolism
    Shewana3_3579
Enzymes [BR:shn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Shewana3_3579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4294551..4295582
Genome map
AA seq 343 aa AA seqDB search
MVRFSVLDPWTDPRGGEIERVRIDNGIIALEVLSLGGIIRSLWTPDKQGQRANIVLGCDS
AEDYLTQNAHLGAIAGRFANRIAMGKLQYQEQEYQLDINQASNCLHGGREGFNRKNWHLG
QLPDGVRLSLVSPDGDMGFPGNCTVQLDYRLAANNLYVEILASVDKPCPVSLTQHSYFNL
DGLPNNHQHRMQIDATRYLTMNEVGVPTGIAEVKNSIFDLTQGVTFGDKLQDPALVRTQG
YDHCYLLDNPDGALRRFGCLSSPVSGRAMTVFTNQPGVQLYCANFLAGTLGRNQQSLAQY
QGVCIEPQKLPDSPNQPQLGDDAWLVPGKIYHHISRYQFDIEG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgtttcagtgtactagatccttggaccgatccccgcggcggtgaaatcgaacgt
gtgcggatagacaatggcatcatcgccttagaagtgctcagtttaggtggcatcattcgc
tcactttggacgcccgataaacaggggcaacgcgccaatatcgtgcttggctgcgacagt
gccgaagattatctaacccaaaacgcccaccttggcgctatcgcagggcgctttgccaac
cgtattgcgatgggcaagctgcaatatcaagagcaagagtatcaactggatatcaatcag
gccagcaactgcttgcacggtggccgcgaaggttttaatcgaaagaactggcacttaggc
caacttcccgacggtgtgcgtttatcgttagtcagcccagatggggacatgggtttcccc
ggcaattgcactgtccagttagactatcgcctcgccgccaataatctctatgtggaaatc
ctcgcctcggtggataaaccctgccccgtcagtctgacgcagcattcctacttcaacctc
gatggcttaccaaataatcatcagcatcggatgcaaatcgatgctacgcgctacctcacc
atgaatgaggtgggcgtgcctacggggattgctgaggtcaaaaacagtattttcgattta
actcagggcgttacttttggggacaaactccaagatccggcgctggtccgcacccaaggt
tatgatcattgttatctgctggataatcccgatggcgcgctgcgccgctttggctgccta
tcgagccctgtcagtggccgcgccatgactgtctttactaatcagcccggcgtgcagctc
tactgcgctaactttttagcgggaaccttagggcgaaaccagcaaagtttggctcagtat
caaggcgtgtgtattgagccgcaaaaattgcctgactcgccgaatcaaccccaattgggt
gatgacgcttggttagtaccggggaaaatctaccatcatatcagccgctatcaatttgat
attgaaggctaa

DBGET integrated database retrieval system