KEGG   Shewanella sp. ANA-3: Shewana3_3810Help
Entry
Shewana3_3810     CDS       T00428                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
shn  Shewanella sp. ANA-3
Pathway
shn00230  Purine metabolism
shn01100  Metabolic pathways
Module
shn_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Shewana3_3810
Enzymes [BR:shn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Shewana3_3810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 MMR_HSR1 RsgA_GTPase AAA_33 AAA_22 AAA_29 AAA_18
Motif
Other DBs
NCBI-ProteinID: ABK50028
JGI: Shewana33810
UniProt: A0L1V9
Position
4576589..4577212
Genome map
AA seq 207 aa AA seqDB search
MTARGNLFIVSAPSGAGKSSLISALLKDKPVDMQVSVSHTTRAPRPGEVNGQHYHFVNVE
EFKALIAQNAFFEWAEVFGNYYGTSRHVIEHTLTQGIDVFLDIDWQGAQQVKAVMPEAIG
VFILPPSRDELERRLTGRGQDSQEVIASRMAQAVSEMSHYKEYDFIIVNDDFDTALADLR
AIIRSQRLTGASQIHAQNDMLNDLLAG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcggaaatttatttattgtttcagccccgagtggtgctggtaaatcctcg
ctgatttcggcgctgctgaaagacaaacccgtcgacatgcaggtttcagtgtcgcacact
acccgtgcgcctcgccctggcgaagtgaatggtcagcactaccattttgttaatgttgaa
gaatttaaagcactgatcgcgcaaaatgcctttttcgagtgggccgaagtgttcggtaac
tactatggcacttcacgccacgtcattgagcacactttgactcaaggtatcgatgttttc
ctcgatatcgactggcaaggcgcccagcaagtcaaagccgtgatgccagaggccattggt
gtatttattctaccgccctcacgggatgagctagaacgtcgcctcactggccgtggccaa
gacagtcaggaagttatcgccagccgtatggcacaggcggtttctgaaatgtcgcactat
aaagaatatgattttattatcgtcaatgacgattttgacacagcactggccgatctgcgg
gcgatcattcgcagccaacgcttaacgggtgctagtcagatccacgcgcaaaatgatatg
cttaacgatctgttggcaggctaa

DBGET integrated database retrieval system