KEGG   Shewanella sp. ANA-3: Shewana3_4056Help
Entry
Shewana3_4056     CDS       T00428                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
shn  Shewanella sp. ANA-3
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Shewana3_4056
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Shewana3_4056
Enzymes [BR:shn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Shewana3_4056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4873963..4875069
Genome map
AA seq 368 aa AA seqDB search
MTDSPRKRIVVKVGSALIAPHKQGCSSHYLLGIAQFITYCRVQGIQVVLVSSGSVAAGWH
HFEGQAQPSVTVKKAMAAAGQADMMATWNKLFDFPTAQLLLTHGDLRNRERYISIRDTIF
SLLEHGLMPIINENDAVTADKLKVGDNDNLSAMVAAAADADTLVICSDVDGLYDQNPHEH
PNAKLIKQVTEINADIYAMAGGVSSDVGTGGMRTKIQAAEKAISHGIETFIINGFNADSF
SQLLKGQNPGTLFTPYEKPMQEHLHWMTHTSQAQGEVIVEDDFDLALDQHSEQLTSDDVV
EVKGDFSVGDTILVRKGDGTKLAKAKSNYSSCLLSFITEQDDQAFASEFQQKTGPIISDK
NIAILKSI
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgacagactctccccgtaaacgtatcgtcgtcaaagtggggagcgccttaatcgcgccc
cacaagcaaggttgcagtagtcattatctcttggggatcgcgcagtttattacttattgc
cgtgtccaaggtattcaagtggtattggtttcatccggctcggttgccgctgggtggcat
cattttgagggccaagctcagccgagtgtcacggtcaaaaaggccatggcggccgcgggt
caggcggatatgatggcgacgtggaataagctatttgattttcctaccgcccaactgctg
ctgacccatggcgacttacgtaatcgcgagcgttatatcagtattcgagacactattttt
agcctgctcgaacacggtttaatgccgattatcaatgagaatgacgccgtgaccgccgac
aaactcaaggttggcgataacgataatctctcggccatggtggcggctgcggccgatgcc
gacaccttagtgatttgctcggatgtggatggactctacgatcaaaatccccacgagcat
cccaatgccaagttgataaagcaagtcactgaaatcaatgccgatatctatgccatggcg
ggaggcgtcagcagcgatgttggcaccggaggcatgcgcactaagatccaagccgccgag
aaagccatctcccacggcattgagacctttattatcaatggctttaatgccgattccttt
agccaactgctaaaggggcaaaatccgggcaccctctttaccccctacgaaaaaccgatg
caggaacatttgcattggatgacccacacctcgcaagcgcagggcgaagtgatcgtcgag
gatgattttgacctagcactcgatcagcacagcgagcaattaactagcgatgatgtggtt
gaagtcaaaggggatttctcagtgggcgacaccattctggtgcgtaaaggcgatggcact
aagttggcgaaagccaaatctaactacagcagttgcctactgagttttattaccgagcag
gatgatcaggcgtttgccagtgagttccaacaaaaaactggccccatcatttccgataag
aatatcgccattcttaaatccatttga

DBGET integrated database retrieval system