KEGG   Shewanella sp. ANA-3: Shewana3_4060Help
Entry
Shewana3_4060     CDS       T00428                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
shn  Shewanella sp. ANA-3
Pathway
shn00620  Pyruvate metabolism
shn00630  Glyoxylate and dicarboxylate metabolism
shn01100  Metabolic pathways
shn01110  Biosynthesis of secondary metabolites
shn01120  Microbial metabolism in diverse environments
shn01200  Carbon metabolism
Module
shn_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Shewana3_4060
   00630 Glyoxylate and dicarboxylate metabolism
    Shewana3_4060
Enzymes [BR:shn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Shewana3_4060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TilS
Motif
Other DBs
NCBI-ProteinID: ABK50277
JGI: Shewana34060
UniProt: A0L2K8
Position
4880082..4880645
Genome map
AA seq 187 aa AA seqDB search
MNMSIINSHQIQPNLNSFIAEEVLAVAQVNVAEHEKLAQAKQFLDRHFPLDTGSHQDVIS
YVVYYQHLLAFFADGSHSGLRQTKQFVAFNGTKDAPSAIVLQDQGCHVELCFDRTGMIGA
RDLANLEDVQIEAPVELAAEPTETRNTTSRHWLSLLHAGMPSANDIQDKLFTAKDGGDYS
LQRIVNL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgtcaattatcaatagccaccagatccaaccgaatctaaacagcttcatcgca
gaagaagtgcttgccgtcgcccaagtgaacgtggccgagcatgaaaaactagcccaggcg
aagcagttcctcgaccgtcatttcccactggatacgggttcgcatcaggatgtgatcagc
tatgtagtttactaccaacacctgctggcattttttgccgacggcagccacagcggatta
cgccaaaccaagcagtttgttgccttcaacggcactaaagatgcgccaagcgccatagtg
ttacaggaccaaggctgccatgtggagttgtgttttgaccgcactggcatgataggtgcg
cgggatttagcgaatttggaagatgtgcaaatcgaagcgcccgttgagttagccgccgaa
cccactgagacacgcaacaccacctcgcgccactggttaagcctgttacatgcgggaatg
ccaagcgctaacgatattcaagacaagctgtttaccgctaaagatggtggcgactacagt
ctgcaacgtatcgtaaatctctaa

DBGET integrated database retrieval system