KEGG   Shewanella sp. ANA-3: Shewana3_4119Help
Entry
Shewana3_4119     CDS       T00428                                 

Definition
alpha/beta hydrolase fold domain-containing protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
shn  Shewanella sp. ANA-3
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:shn00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4943969..4944982
Genome map
AA seq 337 aa AA seqDB search
MSQTPLNFPREEFSKVAFSTEHDLNTSEQQAFWQTVVQDTLKTPDGLTLAYMMVKHPKAH
ASIVISSGRVESYLKYQELVFDLYQQGYSVFAIDHRGQGLSSRMTANPHQGHVRRFNDYI
DDFALFMQTVVLKHATSPLFLLGHSMGGAIGTLYLKQHPDVFTAAAFSAPMYGIKLPMPK
GFVRWLASKLDASLNGGEPNYVLSGQNYKAAPFKGNDLTHCQSRYQAYRELYDAAPKLQL
GSPTNRWLTESLDAADACVLATAHIRTPILILQASEDKIVDNAAQNLAVSSNCQLKVIAG
AAHEIFMEKDSYRNQALNYALDFFKRYATRDVDKQAV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaacgcccctaaactttccaagggaagagttttccaaggtagctttttcaacg
gaacacgatttaaatacttctgaacagcaagccttctggcaaaccgttgtccaagacact
ctcaaaacgcccgatggattaaccttggcctacatgatggtcaagcatcccaaggcccat
gccagcatagtcatcagcagcggtcgggttgaatcctacttaaagtatcaagaattggta
tttgatttgtaccagcaaggctattcggtatttgccatcgatcaccgcggccagggatta
tcgagccgcatgacggccaatccccatcaaggccatgtgcggcggttcaacgactatatc
gacgactttgccctgtttatgcaaaccgttgtgctcaaacatgccacttcgccactgttc
ttgctcgggcattctatgggcggcgccatcggtaccttgtatctcaaacaacatccggat
gtgtttacggcggcggcattttcagctcccatgtatggcattaagttacctatgccgaaa
gggtttgtccgttggcttgcgagtaagctcgatgccagtctcaacggcggagagcctaac
tatgtcctcagcgggcaaaactataaggccgctccttttaagggaaatgatctcacccac
tgccagagccgttatcaagcctaccgagagttgtacgatgcggcgccgaagctgcaatta
ggctcaccgactaaccgctggttgactgaatccttagatgcggccgatgcctgtgttttg
gccacggcacatatccgcacgcccattctgatcctgcaagccagtgaggataagattgtc
gacaatgccgcccaaaatctggcggtaagctcaaattgccaattaaaagtgattgcaggg
gcagcccatgagatttttatggagaaagatagctaccgtaatcaagcgcttaattacgca
ctcgacttttttaaacgctacgcaacaagggacgtggacaaacaagctgtttaa

DBGET integrated database retrieval system