KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_0163Help
Entry
SHJGH_0163        CDS       T02531                                 

Definition
putative alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:sho00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SHJGH_0163
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SHJGH_0163
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SHJGH_0163
Enzymes [BR:sho01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SHJGH_0163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
208248..209888
Genome map
AA seq 546 aa AA seqDB search
MTPAARPSQHAPELRAAARHLGRRRFLTMTGAAAALAFAVNLPAAGTAAAAELDARRITD
DPFTLGVASGDPLPGSVLLWTRLAPQPYQPDGGLPAQRVTVHWELAHDADFRRIVRRGTA
PAHPEFSHTVHVEVPHLPADRVFFYRFRAGAWLSPTGRTRTAPLPGTRPAALTLGAVSCQ
AYADGYYTAYRHLAEDDVDVVFHLGDYLYEYAVNATGNDRKYTDRTLPAHYNHETVTLED
YRLRYALFKSDPDLMAAHAAHPFVVTWDDHETENNYADDTPEDGGSSEEFLLRRASAYRA
YWENQPLRRPQLPTGSDMRLYRRLHWGRLAQFDVLDTRQYRSDQAYGDGWQYPGPESEDP
ARTLTGATQERWLIDGWRASRALWNVVPQQVTFSQRYNTTATPSKVSMDSWDGYPASRER
ILAGADAAGVENLMVLTGDVHVHYAFDIKRDFGDPGSRTVGTEIVTTSITSGRDGADRPG
NWATYLAANPHMKFYNGRRGYVTVTLGQEAARADFKTVPYVTRPGAPVTTAASFVTEAGA
PGLKPA
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgacacccgcagcacgcccgtcccagcacgcgcccgaactgcgcgccgccgcccggcac
ctcggccggcgccgcttcctcaccatgaccggcgccgccgccgcgctcgccttcgcagtg
aacctgcccgccgccggcacggccgccgccgccgagctcgacgcccggaggatcaccgac
gaccccttcacgctgggcgtggcctccggcgacccgctgcccggctcggtcctgctgtgg
acccggctggccccgcagccgtaccagcccgacggcggactgcccgcgcagcgcgtcacc
gtgcactgggagctggcccacgacgcggacttccgccggatcgtcaggcgcggcaccgcc
cccgcccaccccgagttcagccacaccgtccacgtcgaggtgccccacctgccggcggac
cgcgtcttcttctaccgcttccgggccggcgcctggctgagcccgaccggccgcacccgc
accgccccgctgcccggcacccgccccgccgcgctcaccctgggcgccgtctcctgccag
gcctacgccgacggctactacaccgcctaccgccacctcgccgaggacgacgtggacgtc
gtcttccacctgggcgactacctgtacgagtacgccgtcaacgccaccggcaacgaccgc
aagtacaccgaccggaccctcccggcccactacaaccacgagacggtgacgctggaggac
taccggctgcgctacgccctgttcaagtccgacccggacctgatggccgcgcacgccgcg
caccccttcgtcgtcacctgggacgaccacgagacggagaacaactacgccgacgacacc
ccggaggacggcggctcctccgaggagttcctgctgcgccgcgcctccgcctaccgcgcc
tactgggagaaccagccgctgcgccggccgcagctgcccaccggctccgacatgcggctc
taccgccgcctgcactggggccggctcgcccagttcgacgtcctggacacccgccagtac
cgctcggaccaggcctacggcgacggctggcagtaccccggccccgagtccgaggacccg
gcgcgcacgctcaccggcgccacgcaggagcggtggctgatcgacggctggcgcgcctcg
cgggcgctgtggaacgtcgtaccgcagcaggtcaccttctcccagcggtacaacaccacg
gctacgccgtccaaggtctccatggactcctgggacggctacccggcctcccgcgagcgg
atcctggcgggggccgacgccgccggcgtggagaacctcatggtcctcaccggcgacgtg
cacgtgcactacgcgttcgacatcaagcgcgacttcggcgaccccggttcccggaccgtg
ggcacggagatcgtcaccacgtcgatcaccagcgggcgcgacggcgcggaccggcccggc
aactgggccacctacctcgcggccaacccgcacatgaagttctacaacggacggcgcggc
tacgtgaccgtcacgctcggacaggaagcggcccgcgccgacttcaagaccgtcccgtac
gtcaccaggccgggcgcacccgtcaccaccgcggcctccttcgtcacggaagccggcgcc
cccgggctcaagcccgcctga

DBGET integrated database retrieval system