KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_0519Help
Entry
SHJGH_0519        CDS       T02531                                 

Definition
glucosidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sho00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sho00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
633081..634613
Genome map
AA seq 510 aa AA seqDB search
MTVSALVGAGPAAHADRAAGGPPGHGRIVTGTYSTGAARAWLPLPEVRTGTDPGGPVDAT
VVADPKAVRQQYAGVGFSLDETSVSNLWKLTPAEREKAVRLLVDPVHGAGLDRFRLTIGS
PDLIEHLPFWSEDDLPAGVTDDFGLKHFSIRRDIDLHIIDTIKLIQRYNPHATFFASAWS
APAWMKTNNRFTGQVALKPGSSTEYYQVGKLRDDCIDVFARYYVKFVQAYARHGIRVDAL
TLLNEPGMDVVYPAMDISVAQQQKLALAIKREFRAARLNTQLYVHDFNFWDWRDPNSTAT
KNYHRIFDDAPDGSVTGEQVREAADAIAFHPYWGDPRVMRDAYEQTGKPVQLTETSDLSP
STILDDFRLDAGSYILWAQTTDQDGGTLHWTPARDNDVDWDQVAATTKWRDRLVTVNTAT
RGFTVRDELYPIGQFAKYLSPGDVRLESSAAEHGIGNVVYRTKDGAFVAVLGNSTHTDGK
VRISVAGQSFVVTVPADSYATYRWRGGPGH
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgtccgcgctggtcggcgcgggcccggccgcgcacgccgaccgagccgcgggc
ggaccgcccggacacggccggatcgtgaccggcacctactccaccggcgccgcgcgggcc
tggctgccgctgccggaggtcaggaccggcaccgaccccggcggcccggtcgacgccacc
gtcgtcgcggacccgaaggccgtccggcagcagtacgcgggcgtgggcttctccctggac
gagacgagcgtgtccaacctgtggaagctcacccccgccgagcgggagaaggccgtccgg
ctgctcgtcgaccccgtgcacggcgcgggcctggaccggttccggctgacgatcggcagc
cccgacctcatcgagcacctgccgttctggtcggaggacgacctgcccgccggagtcacc
gacgacttcgggctgaagcacttctccatccggcgggacatcgacctgcacatcatcgac
acgatcaagctcatccagcgctacaacccccacgccaccttcttcgcctcggcgtggagc
gcaccggcgtggatgaagacgaacaaccgcttcaccgggcaggtcgcgctcaagcccggg
agcagcacggagtactaccaggtcggcaagttgcgggacgactgcatcgacgtcttcgcc
cggtactacgtcaagttcgtccaggcgtacgcccggcacggcatccgggtcgacgccctg
accctgctgaacgagccgggcatggacgtcgtctacccggccatggacatcagcgtcgcc
cagcagcagaagctggccctggcgatcaagcgggagttccgggccgcccggctgaacacc
cagctctacgtccatgacttcaacttctgggactggcgcgaccccaacagcacggccacc
aagaactaccaccgcatcttcgacgacgcccccgacggctcggtgaccggcgagcaggtc
cgcgaggcggccgacgccatcgccttccacccttactggggcgacccgcgcgtcatgcgc
gacgcctacgaacagacgggcaagccggtccagctcacggagacgagcgacctgtccccc
tcgaccatcctcgacgacttccgcctcgacgccggttcctacatcctgtgggcccagacc
accgaccaggacggcgggacactgcactggacaccggcccgggacaacgacgtcgactgg
gaccaggtcgcggccaccaccaagtggcgggaccggctggtgacggtgaacacggccacg
cgcggcttcaccgtccgcgacgagctgtacccgatcgggcagttcgccaagtacctctcg
cccggcgacgtacgcctcgaatccagcgccgccgagcacggcatcggcaacgtcgtctac
cgcacgaaggacggcgccttcgtggccgtcctcggcaacagcacccacaccgacggcaag
gtccggatctccgtcgccggccagtcgttcgtggtgacggtcccggcggactcctacgcc
acctaccgctggcgcggcggccccggccactga

DBGET integrated database retrieval system