KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_0954Help
Entry
SHJGH_0954        CDS       T02531                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sho00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SHJGH_0954
Enzymes [BR:sho01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SHJGH_0954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1109989..1111263
Genome map
AA seq 424 aa AA seqDB search
MNPRSLRRRAAVVVAALTAGAALTATQAQATPTRDVLTPATKFYVDPHSKAAKQALVDFG
NGDVGNAVNMAKLASWPQAEWFTEGTPDEVRGKVGELVHRARAVGRTPVLVAYNVPGRDC
TQYSSGGAASSAAYRQWIDAFAAGIGTSKAVVVVEPDGTALLPEDCGPTTDPTGELTAAR
IADLAYAVKTLKAKPRTVVYLDAGNVQWRPVGEMAQRLLDAGVRHSDGFALNVSNTHPTD
HNARYGTWIAKCMWYATEGPEEARGHAERCAGQYYSAAAPNDGTPGNAVSSTDPTTWRWT
DAWYDQNVGTPPADGLRHFVIDTSRNGLGAWTPEPGKYTGDPEVWCNAPGRGLGPRPTAD
TGVPLVDAYLWIKIPGESDGSCTRNTGGTIDPEYGVVDPPAGTWWPDQAHALARNAAPRL
AFNR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaatccacgcagccttcggcgccgcgcggccgtcgtcgtcgcggccctcaccgcgggc
gccgctctcaccgcgacgcaggcgcaggccacacccacgcgggacgtgctcaccccggcc
acgaagttctatgtggacccgcacagcaaggccgcgaagcaggccctcgtggacttcggg
aacggcgacgtcgggaacgccgtgaacatggccaagctcgccagctggccgcaggccgag
tggttcaccgagggcacgcccgacgaggtgcgcggcaaggtcggcgagctcgtccaccgg
gcccgggccgtgggccgtaccccggtgctggtcgcctacaacgtcccgggccgggactgc
acgcagtactccagcggcggagccgcatcctccgccgcctaccggcagtggatcgacgcc
ttcgccgccggcatcggcaccagcaaggcggtggtcgtcgtcgaacccgacggcacggcc
ctcctccccgaggactgcggacccaccaccgacccgacaggcgaactcaccgccgcccgc
atcgccgacctggcctacgccgtgaagaccctgaaggccaagccgcgcacggtggtctac
ctggacgcgggaaacgtccagtggcggcccgtcggtgagatggcccagcggctgctggac
gccggggtccggcacagtgacggcttcgccctcaacgtgtccaacacccaccccaccgac
cacaacgccagatacggcacctggatcgccaagtgcatgtggtacgccaccgaggggccc
gaggaggcgcgtggccacgccgagcggtgcgccggccagtactactcggcggctgccccg
aacgacggcacccccggcaacgcggtctcctccaccgacccgaccacctggcggtggacc
gacgcctggtacgaccagaacgtgggcaccccgccggccgacgggctgcgtcacttcgtg
atcgacaccagccgcaacggcctgggcgcctggaccccggagccgggcaagtacacgggg
gatccggaggtctggtgcaacgcacccggccgcggtctcggcccgcgccccaccgccgac
accggcgtacctctcgtcgacgcctatctgtggatcaagatccccggcgagtccgacggt
agctgcacgcgcaacaccggcggcaccatcgaccccgagtacggcgtcgtggacccgccc
gccggcacctggtggcccgaccaggcccacgccctggcccgcaacgcggcaccgcgcctg
gccttcaaccgctga

DBGET integrated database retrieval system