KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_1319Help
Entry
SHJGH_1319        CDS       T02531                                 

Definition
aldehyde-alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sho00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SHJGH_1319
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SHJGH_1319
   00620 Pyruvate metabolism
    SHJGH_1319
   00650 Butanoate metabolism
    SHJGH_1319
  Lipid metabolism
   00071 Fatty acid degradation
    SHJGH_1319
  Amino acid metabolism
   00350 Tyrosine metabolism
    SHJGH_1319
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SHJGH_1319
   00626 Naphthalene degradation
    SHJGH_1319
Enzymes [BR:sho01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SHJGH_1319
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SHJGH_1319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1542304..1544991)
Genome map
AA seq 895 aa AA seqDB search
MTRLEAGTQATAAADPPSEITIAVDRLVTNGVKALADYDCLTQEQVDHIVKKASVTALDQ
HTALARLAVEETGRGVFEDKAAKNMFACEHVTHSMGPMKTVGVIARDDIEDMIEVAEPVG
VVCAITPVTNPTSTTVFKALMALKTRNPIVFAFHPSAQRCSMEAARIVRDAAVAAGAPEN
CVQWIETPSVEATGILMRHPGVSLILATGGNAMVRAAYSVGKPALGVGAGNVPAYLHKSA
KLRRAVNDLVLSKSFDNGMICASEQAVILDDEIYDAALAEFRTLHAHVATSEEKAKLEAF
LFPAGRANAGCEPKVNAAAVGQSPAWIAEQAGFTVPTDTSLILVEAERVGPDEPLTREKL
CPVLAVLRADSEQHGFDLAADMVAFHGQGHTAVIHTEDPALAEAYGRRMKTVRIIVNAPS
SQGAIGGIYNSLMPSLTLGCGSWGHTSVSNNVSAVQLLNIKRVSARRNNMQWFKVPPKIY
FEPQSLRYLSAMPDVHRVTVVTDATMTRLGFVDRVSRVLQLRHKPVTLQIIDNVEPEPSI
DSVQRGAQLMRDFRPDTIIALGGGSPMDAAKVMWLLYEHPDIDFADMRQKFSDIRKRAFR
FPALGTRGRLVCVPTTSGTGAEVTPFAVISDPANGKKYPLADYALTPSVAIVDPLLTADL
PPALAADSGFDALTHAIEAYVSVYANDFTDGLALHAIRLIFDNIEAAVNDRRGRPDAREK
MHNAGTIAGMAFGNAFLGIVHAMSHTLGATFHIAHGRTNAVLLPHVIRYNGTVPAKLTGW
PKYENYRAPERFRDIARTLGLPASSAQEGVESLADAVERLRDAVGIEPSFQALGIDERTF
LEALPQQALNAYEDQCAPANPRMPMLDDMQEIMRTAYSWRAQGRPDPDKGRTALA
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtcttgaggccggaacccaggcaacagcagctgcggacccgccgtccgagatc
accatcgccgtggaccggctggtcacgaacggagtcaaggcgctcgccgactacgactgc
ctcactcaggagcaggtcgatcacatcgtcaagaaggcgtcggtcaccgccctggaccag
cacacggcgctggcccggctcgccgtggaggagaccggacgcggagtcttcgaggacaag
gcggccaagaacatgttcgcgtgcgagcacgtcacgcacagcatgggcccgatgaagacc
gtcggcgtcatcgcacgcgacgacatcgaggacatgatcgaggtggccgagccggtcggc
gtggtctgcgcgatcacgccggtcaccaacccgacctccaccaccgtcttcaaggccctg
atggcgctgaagacgcgcaacccgatcgtgttcgccttccacccttcggcccagcggtgc
agcatggaggcggcccggatcgtacgggacgcggcagtggccgccggcgcgccagagaac
tgtgtgcaatggatcgagaccccgtcggtcgaggcgaccggcatcctgatgcgccacccc
ggcgtctcactgatcctcgccaccggcggcaacgccatggtcagggccgcctactcagtg
ggcaaacccgcccttggagtcggcgcgggcaacgttcccgcctacctgcacaagagcgcc
aagctgcgccgcgccgtcaacgacctcgtgctgtccaagtccttcgacaacggcatgatc
tgcgcctccgaacaggccgtcatcctggacgacgagatctacgacgcggccctcgccgaa
ttccgcactctgcacgctcacgtggcgaccagcgaggagaaggcgaagctggaagccttc
ttgttcccggctggccgggccaacgccgggtgcgagcccaaggtcaacgccgcggccgtc
ggtcagagcccggcatggatcgccgaacaggccggcttcaccgtgccgaccgacacctca
ctgatcctggtcgaggccgaacgggtgggcccggacgagccgctgacccgtgagaagctc
tgcccggtgctcgccgtgctgcgcgccgactccgagcagcatggcttcgacctcgccgcc
gacatggtcgccttccacggccaaggccacaccgcggtcatccacaccgaagacccggca
ctcgcggaggcgtacggccggcgtatgaagaccgtacgaatcatcgtcaacgctccgtcc
tcgcagggagccatcggcggcatctacaacagtctgatgccgtcgctcaccctgggctgc
ggctcctgggggcacacctccgtgtccaacaacgtctccgccgtccagctgctgaacatc
aagcgggtcagcgcccgccgcaacaacatgcagtggttcaaggtcccgccgaagatctac
ttcgagccgcagtccctgcgctacctgtccgccatgccggacgtccaccgcgtcacggtc
gtcaccgacgccaccatgacccgcctcggcttcgtcgaccgcgtcagccgagtgctgcag
ctccgccacaagccggtcaccctccaaatcatcgacaatgtcgagccggagccgagcatc
gactccgtccagcggggcgcccagctcatgcgggacttccgcccggacaccatcatcgct
ctcggcggcggctcgccgatggacgcggccaaggtgatgtggctgctgtacgagcacccg
gacatcgacttcgccgacatgcggcagaagttctccgacatccgcaagcgagccttccgc
ttcccggccctgggcacccggggccgcctggtatgcgtgcccaccacgtccggcaccggc
gccgaagtcaccccgttcgcggtgatctccgaccccgccaacggcaagaagtacccgctc
gccgactacgcgctgaccccgagcgtggccattgtcgacccgctgctcaccgcggacctg
cctccggcgctggcggccgacagcggcttcgacgccctcacccacgccatagaggcgtac
gtgtccgtctacgccaacgacttcaccgacggcctggccctgcacgcgatccggctgatc
ttcgacaacatcgaggcggcggtgaacgaccgcaggggccgacccgacgcgcgggagaag
atgcacaacgccggcacgatcgccggcatggccttcggcaacgccttcctcggcatcgtg
catgccatgtcgcacaccctcggcgccaccttccacatcgcgcacggccgcaccaacgcg
gtcctgctgccccacgtgatccgctacaacggcaccgtcccggcgaaactcaccggctgg
cccaagtacgagaactaccgtgctcccgaacgcttccgggacattgcccgcaccctcggt
ctgcccgcctccagcgcgcaggagggcgtggagtcgctggccgacgcggtggagcggctg
cgtgacgccgtgggcatcgagccgtcgttccaggccctcggcatcgatgagcgcacgttc
ctggaggctctgccgcagcaggcgctgaacgcctacgaggaccagtgcgcgccggcgaac
ccgcgcatgccgatgctcgacgacatgcaggagatcatgcgcacggcctactcctggcgt
gcgcagggccgaccggacccggacaagggccgaacggccctggcgtga

DBGET integrated database retrieval system