KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_1851Help
Entry
SHJGH_1851        CDS       T02531                                 

Definition
(RefSeq) putative ATP-dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sho00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    SHJGH_1851
Enzymes [BR:sho01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SHJGH_1851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2236424..2237446
Genome map
AA seq 340 aa AA seqDB search
MTVSGVVEISAVTAVTLPLIPPMLATPGSLPPAAQDARWAYETKQDGQRVMVYLPGDGSV
LLRARSGEDITGAYPELRPLGGALGSTPAVLDGEVLALDARGRADFQLLQSRMGLAHAPA
RAARRAAQVPVHLVLFDVPHLEESLVRLPYVRRRARLEELALAGPYWSTPGAVTGHGAEA
LAATREHGLEGLVCKRLDSVYEPGVRSRAWIKIRNMRAEDVIVGGWLPGKGRLTGLPGAV
LVGQRDPEGRLRYVGGVGTGWSEAERVRLADLLRDTASDRCPFEPVPRVPGARWVLPRLV
GEVSYSTRTRNGMLRQPSWLRLRPDLTPEESAADLPGESG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtgtcgggggtggtcgagatctctgccgtgaccgccgtgaccctgccgctcatt
ccgccgatgctcgcgacgcccggcagcctgccgcccgccgcgcaggacgcgcggtgggcg
tacgagaccaagcaggacggccagcgggtgatggtgtacctgccgggcgacggcagtgtg
ctgctgcgcgcccgctcgggcgaggacatcaccggcgcctacccggagctccggccgctc
ggcggggcgctgggcagcacacccgcggtgctggacggggaggtgctggccctggacgcg
cggggccgggccgacttccagctcctccagagccggatgggcctcgcgcacgcccccgcg
cgggcggcgcgccgggccgcgcaggtcccggtgcacctggtgctgttcgacgtgccccat
ctggaggagtccctggtacggctgccatacgtccggcggcgggcgcggctggaggaactg
gcgctcgcggggccgtactggtcgacgccgggagcggtgaccgggcacggtgccgaggca
ctcgcggcgaccagggaacacggcctggagggcctggtgtgcaagcggctggactcggtg
tacgaacccggcgtgcgctcccgcgcctggatcaagatccggaacatgcgggccgaggac
gtgatcgtcggcggctggctgcccggcaaggggcggctgaccggactgcccggcgcggta
ctggtcggccagcgcgacccggagggcaggctgcggtacgtcggcggggtgggcaccggc
tggagcgaggccgagcgggtccggctggcggacctgctgcgggacacggcgagcgaccgg
tgccccttcgagcccgtgccgcgcgtgcccggcgcccggtgggtgctgccccggctggtg
ggcgaggtcagctacagcacccgtacccggaacggcatgctgcgccagccctcctggctg
cggctgcgcccggatctcactccggaggagtctgcggccgacctgcccggggaatccggc
tga

DBGET integrated database retrieval system