KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_1865Help
Entry
SHJGH_1865        CDS       T02531                                 

Definition
putative 1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:sho00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SHJGH_1865
Enzymes [BR:sho01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SHJGH_1865
Exosome [BR:sho04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SHJGH_1865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2252451..2254652
Genome map
AA seq 733 aa AA seqDB search
MALKDTTPPEAAGPRPSAAVALDPADRGRLLAGAHHDPHSVLGAHPVPGGTLLRALRPNA
RAVSVVIDGTPTELRSEGDGLFAAVLPCTEVPSYTLLVAYDDTEQEVHDPYRFLPALGEL
DLHLIREGRHEQLWRALGAEPMVHQGVAGTRFTVWAPNAQGVRVAGDFTYWDGTQYPMRS
LGASGVWELFLPGIGEGTRYKFEITSRYGHRFLKADPMARGTEVPPDTASVVTSSHYEWG
DAEWMAHRGDTPVHQAPFSVYEVHLPSWRPGLTYRQLAEELPPYVKGMGFTHVELMPVAG
YPFSGSWGYQVTSYYAPTPRLGPPDDFRYFVDACHRAGLGVIMDWVPAHFPKDDWALARF
DGDPLYEPGNALRAEHPDWGTYEFDYGRTEVRNFLVANAVYWCEEFHIDGLRVDAVASML
YLDYSRDSGQWEPNVFGGREDLDAVAFLQEMNATVYRRCPGVVTIAEESTAWDGVTRPTD
GGGLGFGLKWNMGWMHDSLEYIQKEPVHRKYHHNEMTFSMVYAYSENYVLPISHDEVVHG
KRALVSKMPGDWWQRRANHRAYLGFMWAHPGKQLLFMGQEFAQGAEWSNTHGPEWWLLSD
DYHSAGDHRGVQALVRDLNTVYRATPALWQRDTDPGGFRWVLCDAADDNVLAFLRFAADG
GPLLAVSNFSPVVRHDYRLWVPDGFPAWREELNTDDTRYGGSGVRTEGPVKPEEGFLRLT
LPPLATVWLTPED
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgaaggacaccacgccccccgaggccgccgggcccaggccctccgcggccgtg
gccctggaccccgccgaccgcggccggctgctggccggcgcgcaccacgatccgcactcc
gtgctgggcgcccacccggtgccgggcggcacgctgctgcgggcgctgcgcccgaacgcg
cgggcggtgagcgtcgtgatcgacggcacgccgaccgaactgcgctcggagggcgacggt
ctgttcgccgccgtcctgccctgtacggaggtcccgtcgtacacgctgctggtggcgtac
gacgacaccgagcaggaggtgcacgacccgtaccgcttcctgcccgccctcggcgaactg
gacctgcacctgatccgggagggccggcacgagcagctgtggcgggcgctcggggccgag
ccgatggtccaccagggcgtggccggcacccgcttcaccgtgtgggcgccgaacgcccag
ggggtgcgggtggccggggacttcacgtactgggacggcacgcagtaccccatgcggtcg
ctcggcgcgtccggggtgtgggagctgttcctgcccgggatcggcgagggcacccggtac
aagttcgagatcacctcgcggtacgggcaccggttcctgaaggcggacccgatggcgcgg
ggcacggaagtcccgccggacacggcgtccgtcgtgacgtcctcgcactacgagtggggt
gacgcggagtggatggcgcaccgcggtgacaccccggtgcaccaggcgccgttctcggtg
tacgaggtgcacctgccgtcctggcgaccggggctgacgtaccgtcagctcgcggaggaa
ctcccgccgtacgtcaaggggatgggcttcacgcacgtggagctgatgccggtggccggg
tacccgttcagcggctcctggggctaccaggtcacctcctactacgcgccgacgccccgg
ctcggccccccggacgacttccggtacttcgtggacgcctgtcaccgggccggtctcggc
gtgatcatggactgggtgccagcgcacttccccaaggacgactgggcgctggcccggttc
gacggggacccgctgtacgagcccgggaacgcgctgcgggcggagcacccggactggggg
acgtacgagttcgactacggccgcaccgaggtgcgcaacttcctcgtcgccaacgcggtg
tactggtgcgaggagttccacatcgacgggctgcgcgtggacgccgtcgcctcgatgctc
tacctggactactcgcgggactccgggcagtgggagcccaatgtgttcggcggccgggag
gacctggacgcggtggccttcctccaggagatgaacgccaccgtgtaccggcgctgcccg
ggcgtggtgaccatcgccgaggagtccaccgcgtgggacggcgtgacccggccgacggac
ggcggcgggctcgggttcgggctgaagtggaacatgggctggatgcacgactcgctggag
tacatccagaaggagccggtgcaccgcaagtaccaccacaacgagatgaccttctcgatg
gtgtacgcctacagcgagaactacgtcctgcccatctcccacgacgaggtggtgcacggc
aagcgggcgctggtgtcgaagatgcccggcgactggtggcagcggcgcgccaaccaccgg
gcctacctcggcttcatgtgggcccacccgggcaaacagctgttgttcatggggcaggag
ttcgcccagggggccgagtggtcgaacacccacggccccgagtggtggctgctctccgac
gactaccactccgccggcgaccaccggggcgtccaggccctggtgcgggacctcaacacg
gtgtaccgggcgacgccggcgctgtggcagcgggacaccgacccgggcggcttccggtgg
gtgctgtgcgacgcggcggacgacaacgtgctggcgttcctgcgcttcgccgccgacggc
ggcccgctgctggcggtgtcgaacttctccccggtcgtccggcacgactaccgcctgtgg
gtccccgacgggttccccgcctggcgcgaggagctgaacaccgacgacacccggtacggc
ggcagcggcgtccgcaccgaggggcccgtcaagcccgaggagggcttcctgaggctgacg
ctgcccccgctcgccaccgtctggctgacgccggaggactga

DBGET integrated database retrieval system