KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_1865Help
Entry
SHJGH_1865        CDS       T02531                                 

Definition
putative 1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sho00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2252451..2254652
Genome map
AA seq 733 aa AA seqDB search
MALKDTTPPEAAGPRPSAAVALDPADRGRLLAGAHHDPHSVLGAHPVPGGTLLRALRPNA
RAVSVVIDGTPTELRSEGDGLFAAVLPCTEVPSYTLLVAYDDTEQEVHDPYRFLPALGEL
DLHLIREGRHEQLWRALGAEPMVHQGVAGTRFTVWAPNAQGVRVAGDFTYWDGTQYPMRS
LGASGVWELFLPGIGEGTRYKFEITSRYGHRFLKADPMARGTEVPPDTASVVTSSHYEWG
DAEWMAHRGDTPVHQAPFSVYEVHLPSWRPGLTYRQLAEELPPYVKGMGFTHVELMPVAG
YPFSGSWGYQVTSYYAPTPRLGPPDDFRYFVDACHRAGLGVIMDWVPAHFPKDDWALARF
DGDPLYEPGNALRAEHPDWGTYEFDYGRTEVRNFLVANAVYWCEEFHIDGLRVDAVASML
YLDYSRDSGQWEPNVFGGREDLDAVAFLQEMNATVYRRCPGVVTIAEESTAWDGVTRPTD
GGGLGFGLKWNMGWMHDSLEYIQKEPVHRKYHHNEMTFSMVYAYSENYVLPISHDEVVHG
KRALVSKMPGDWWQRRANHRAYLGFMWAHPGKQLLFMGQEFAQGAEWSNTHGPEWWLLSD
DYHSAGDHRGVQALVRDLNTVYRATPALWQRDTDPGGFRWVLCDAADDNVLAFLRFAADG
GPLLAVSNFSPVVRHDYRLWVPDGFPAWREELNTDDTRYGGSGVRTEGPVKPEEGFLRLT
LPPLATVWLTPED
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgaaggacaccacgccccccgaggccgccgggcccaggccctccgcggccgtg
gccctggaccccgccgaccgcggccggctgctggccggcgcgcaccacgatccgcactcc
gtgctgggcgcccacccggtgccgggcggcacgctgctgcgggcgctgcgcccgaacgcg
cgggcggtgagcgtcgtgatcgacggcacgccgaccgaactgcgctcggagggcgacggt
ctgttcgccgccgtcctgccctgtacggaggtcccgtcgtacacgctgctggtggcgtac
gacgacaccgagcaggaggtgcacgacccgtaccgcttcctgcccgccctcggcgaactg
gacctgcacctgatccgggagggccggcacgagcagctgtggcgggcgctcggggccgag
ccgatggtccaccagggcgtggccggcacccgcttcaccgtgtgggcgccgaacgcccag
ggggtgcgggtggccggggacttcacgtactgggacggcacgcagtaccccatgcggtcg
ctcggcgcgtccggggtgtgggagctgttcctgcccgggatcggcgagggcacccggtac
aagttcgagatcacctcgcggtacgggcaccggttcctgaaggcggacccgatggcgcgg
ggcacggaagtcccgccggacacggcgtccgtcgtgacgtcctcgcactacgagtggggt
gacgcggagtggatggcgcaccgcggtgacaccccggtgcaccaggcgccgttctcggtg
tacgaggtgcacctgccgtcctggcgaccggggctgacgtaccgtcagctcgcggaggaa
ctcccgccgtacgtcaaggggatgggcttcacgcacgtggagctgatgccggtggccggg
tacccgttcagcggctcctggggctaccaggtcacctcctactacgcgccgacgccccgg
ctcggccccccggacgacttccggtacttcgtggacgcctgtcaccgggccggtctcggc
gtgatcatggactgggtgccagcgcacttccccaaggacgactgggcgctggcccggttc
gacggggacccgctgtacgagcccgggaacgcgctgcgggcggagcacccggactggggg
acgtacgagttcgactacggccgcaccgaggtgcgcaacttcctcgtcgccaacgcggtg
tactggtgcgaggagttccacatcgacgggctgcgcgtggacgccgtcgcctcgatgctc
tacctggactactcgcgggactccgggcagtgggagcccaatgtgttcggcggccgggag
gacctggacgcggtggccttcctccaggagatgaacgccaccgtgtaccggcgctgcccg
ggcgtggtgaccatcgccgaggagtccaccgcgtgggacggcgtgacccggccgacggac
ggcggcgggctcgggttcgggctgaagtggaacatgggctggatgcacgactcgctggag
tacatccagaaggagccggtgcaccgcaagtaccaccacaacgagatgaccttctcgatg
gtgtacgcctacagcgagaactacgtcctgcccatctcccacgacgaggtggtgcacggc
aagcgggcgctggtgtcgaagatgcccggcgactggtggcagcggcgcgccaaccaccgg
gcctacctcggcttcatgtgggcccacccgggcaaacagctgttgttcatggggcaggag
ttcgcccagggggccgagtggtcgaacacccacggccccgagtggtggctgctctccgac
gactaccactccgccggcgaccaccggggcgtccaggccctggtgcgggacctcaacacg
gtgtaccgggcgacgccggcgctgtggcagcgggacaccgacccgggcggcttccggtgg
gtgctgtgcgacgcggcggacgacaacgtgctggcgttcctgcgcttcgccgccgacggc
ggcccgctgctggcggtgtcgaacttctccccggtcgtccggcacgactaccgcctgtgg
gtccccgacgggttccccgcctggcgcgaggagctgaacaccgacgacacccggtacggc
ggcagcggcgtccgcaccgaggggcccgtcaagcccgaggagggcttcctgaggctgacg
ctgcccccgctcgccaccgtctggctgacgccggaggactga

DBGET integrated database retrieval system