KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_3273Help
Entry
SHJGH_3273        CDS       T02531                                 

Definition
putative ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sho00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SHJGH_3273
Enzymes [BR:sho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SHJGH_3273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3779794..3780687
Genome map
AA seq 297 aa AA seqDB search
MTHIAVLGSTNMDLVTYVGKAPQRGETVTGREFRTIPGGKGANQAIAAARAGATVSMIGA
VGNDAFGARLRDTLEHSGVDTDFLRTVEGPSGTAHIVVDDEGGNAIVVIPGANGTVDHLS
PGDEGVIATADALLLQLEIPLAAVVAGAQAARRHGIRTVLTPSPVQPLPPELLAAVDLLV
PNEYEAVTLTGRTDPREAAATLLDLVPEVVVTLGATGCLYLTRGAEPLVVPAPRVRAVDS
TGAGDTFVGTLAVALAEEKPVREALSWAATAAAISVQREGASASMPYRPEIEAQYSS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacccacatcgccgtcctcggcagcacgaacatggacctcgtcacgtacgtcggcaag
gccccgcagcgcggggagacggtgacgggccgggagttccgcacgatccccggcggcaag
ggcgccaaccaggcgatcgccgcggcccgcgccggcgccaccgtctcgatgatcggcgcg
gtcggcaacgacgccttcggcgcgcggctgcgcgacaccctcgaacactccggcgtggac
accgacttcctgcgcacggtcgagggcccgtccggcaccgcgcacatcgtcgtggacgac
gagggcggcaacgcgatcgtcgtcatccccggcgcgaacggcacggtcgaccacctctcc
cccggtgacgagggggtgatcgccaccgccgacgccctgctgctgcaactggagatcccg
ctggcggcggtcgtcgccggcgcgcaggcggcccgccggcacggcatccgcaccgtcctc
accccgtcccccgtccagccgctgccgcccgaactcctggccgcagtcgacctgttggtg
ccgaacgagtacgaggcagtcacgctcaccggccgcaccgacccgcgcgaggcggcggcc
accctgctggacctggtgccggaggtcgtggtcaccctgggcgccacgggctgcctgtac
ctgacccggggcgccgaaccgctcgtcgtccccgcgccccgggtgcgggccgtggactcc
acgggcgcgggcgacacgttcgtcggcacgctcgcggtggccctcgccgaggagaaaccg
gtacgggaggccctgtcctgggcggcgaccgcggcggcgatctccgtccagcgggaaggc
gcgtcggcgtcgatgccgtaccgcccggagatcgaggcccagtacagctcatga

DBGET integrated database retrieval system